F294307

General Info

Members Datasets Scaffolds Average Seq Length
191 137 382 230

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0236649|Ga0373953_0236649_34_777
Length 247
Sequence LTDQHQPDFANLEKNGMTNRKIEYWVIPPEADGEFVAHMEEVLETYAKPYDPMRPVLCMDEQPVQLLKETRVPIPATRRHAKRVDYEYERAGTANIFMFAEPLAGWREVTVRDTKTKVDWAVEMALLMEGRYAKVERVTVVCDNLNTHTKGAFYESFAPGRARQLVRRIDFCYTPKHGSWLNIAENELSSMTRQCVAGRRFGDTRSLRAETKAWSTDVNSSQRGVDWQMRIDDARCKLASVYPKIKL

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.81
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0236649 3300035117 Bacteria 792
2 Ga0070683_100342220 3300005329 Bacteria 1424
3 Ga0070670_100240251 3300005331 Bacteria 1577
4 Ga0068869_100637366 3300005334 Bacteria 903
5 Ga0070680_100702442 3300005336 Bacteria 870
6 Ga0068868_100350535 3300005338 Bacteria 1264
7 Ga0070714_100330750 3300005435 Bacteria 1427
8 Ga0070714_100376159 3300005435 Bacteria 1338
9 Ga0070714_100442065 3300005435 Bacteria 1234
10 Ga0070713_100400597 3300005436 Bacteria 1281
11 Ga0070705_100174979 3300005440 Unclassified 1448
12 Ga0070678_100783894 3300005456 Unclassified 864
13 Ga0070681_10280001 3300005458 Bacteria 1578
14 Ga0070681_10423674 3300005458 Bacteria 1243
15 Ga0070681_10969128 3300005458 Bacteria 770
16 Ga0070679_100332191 3300005530 Bacteria 1468
17 Ga0070684_100349321 3300005535 Unclassified 1360
18 Ga0070684_100999207 3300005535 Bacteria 785
19 Ga0070695_100169858 3300005545 Bacteria 1538
20 Ga0070696_100348509 3300005546 Bacteria 1146
21 Ga0070693_100409011 3300005547 Unclassified 943
22 Ga0068855_100353817 3300005563 Bacteria 1617
23 Ga0068855_100692819 3300005563 Bacteria 1091
24 Ga0070664_100480534 3300005564 Bacteria 1143
25 Ga0068857_100286682 3300005577 Bacteria 1515
26 Ga0068854_100254079 3300005578 Bacteria 1405
27 Ga0068856_100167198 3300005614 Bacteria 2210
28 Ga0068852_100454088 3300005616 Bacteria 1269
29 Ga0068852_100647570 3300005616 Unclassified 1064
30 Ga0068866_10156529 3300005718 Bacteria 1325
31 Ga0068860_100443479 3300005843 Unclassified 1290
32 Ga0081538_10038439 3300005981 Bacteria 3087
33 Ga0081539_10190493 3300005985 Bacteria 955
34 Ga0070717_10342986 3300006028 Bacteria 1334
35 Ga0097621_100360310 3300006237 Unclassified 1295
36 Ga0097621_100978639 3300006237 Unclassified 791
37 Ga0068871_100302112 3300006358 Unclassified 1405
38 Ga0068871_100320791 3300006358 Unclassified 1364
39 Ga0068871_100322727 3300006358 Unclassified 1360
40 Ga0075429_100471206 3300006880 Unclassified 1100
41 Ga0105240_10078041 3300009093 Bacteria 4079
42 Ga0105240_10534533 3300009093 Bacteria 1299
43 Ga0105240_11187221 3300009093 Bacteria 809
44 Ga0105245_10346508 3300009098 Bacteria 1470
45 Ga0114129_10436277 3300009147 Unclassified 1720
46 Ga0105242_10185947 3300009176 Bacteria 1836
47 Ga0105238_10378097 3300009551 Bacteria 1407
48 Ga0105029_102442 3300009984 Bacteria 1209
49 Ga0105239_10192693 3300010375 Bacteria 2282
50 Ga0157370_10547429 3300013104 Bacteria 1061
51 Ga0157369_10204167 3300013105 Bacteria 2073
52 Ga0157369_10957038 3300013105 Bacteria 877
53 Ga0157378_10426323 3300013297 Bacteria 1312
54 Ga0157372_10023145 3300013307 Bacteria 6732
55 Ga0157372_10274107 3300013307 Bacteria 1961
56 Ga0157372_10454201 3300013307 Bacteria 1493
57 Ga0157372_11244234 3300013307 Unclassified 860
58 Ga0213872_10106895 3300021361 Bacteria 1244
59 Ga0213874_10039569 3300021377 Bacteria 1404
60 Ga0224572_1021373 3300024225 Bacteria 1241
61 Ga0207642_10150601 3300025899 Bacteria 1238
62 Ga0207663_10659288 3300025916 Unclassified 826
63 Ga0207650_10252223 3300025925 Bacteria 1429
64 Ga0207687_10241517 3300025927 Unclassified 1432
65 Ga0207700_10674388 3300025928 Bacteria 922
66 Ga0207664_10338049 3300025929 Bacteria 1331
67 Ga0207664_10704422 3300025929 Bacteria 908
68 Ga0207689_10311644 3300025942 Bacteria 1305
69 Ga0207667_10267681 3300025949 Bacteria 1747
70 Ga0207667_10403903 3300025949 Bacteria 1391
71 Ga0207667_10832093 3300025949 Bacteria 918
72 Ga0207640_10244321 3300025981 Bacteria 1389
73 Ga0207677_10288337 3300026023 Bacteria 1351
74 Ga0207702_10147943 3300026078 Bacteria 2134
75 Ga0207641_10417682 3300026088 Bacteria 1291
76 Ga0207674_10277946 3300026116 Bacteria 1622
77 Ga0207698_10060886 3300026142 Unclassified 2938
78 Ga0207698_10220398 3300026142 Bacteria 1714
79 Ga0207698_10861948 3300026142 Unclassified 911
80 Ga0209971_1042966 3300027682 Bacteria 1088
81 Ga0209974_10046503 3300027876 Bacteria 1451
82 Ga0268264_10284562 3300028381 Unclassified 1550
83 Ga0268264_10690998 3300028381 Unclassified 1013
84 Ga0265334_10012689 3300028573 Bacteria 3539
85 Ga0265760_10135517 3300031090 Bacteria 799
86 Ga0265331_10268324 3300031250 Bacteria 765
87 Ga0265316_10458010 3300031344 Bacteria 914
88 Ga0316576_10183524 3300031727 Bacteria 1578
89 Ga0373955_0095164 3300035172 Bacteria 1703
90 Ga0373955_0342635 3300035172 Bacteria 905
91 Ga0316574_0456115 3300035398 Unclassified 800
92 Ga0373935_0240662 3300035692 Bacteria 1263
93 Ga0373933_0713711 3300035724 Bacteria 659
94 Ga0373947_0171884 3300035725 Bacteria 1406
95 Ga0373937_0422325 3300036401 Bacteria 1265
96 Ga0373937_0511367 3300036401 Bacteria 1141
97 Ga0316584_0149842 3300036712 Bacteria 1737
98 Ga0373925_0281667 3300037068 Bacteria 1339
99 Ga0395905_0282502 3300037471 Bacteria 1546
100 Ga0436364_0106491 3300037853 Bacteria 2094
101 Ga0436364_1095351 3300037853 Bacteria 1048
102 Ga0400489_29205 3300039093 Bacteria 1873
103 Ga0436365_0448643 3300039437 Bacteria 813
104 Ga0436360_0818206 3300039438 Bacteria 1258
105 Ga0436361_1012120 3300039447 Bacteria 2035
106 Ga0436361_1197039 3300039447 Bacteria 925
107 Ga0436363_0538718 3300039450 Bacteria 1368
108 Ga0436363_1237378 3300039450 Bacteria 1488
109 Ga0436362_1251374 3300039453 Bacteria 930
110 Ga0466966_0180602 3300044684 Bacteria 1280
111 Ga0451576_0479755 3300045051 Bacteria 1306
112 Ga0466958_0223600 3300045836 Bacteria 1201
113 Ga0466967_0334737 3300045976 Bacteria 1462
114 Ga0466967_0487155 3300045976 Bacteria 1209
115 Ga0495651_0270442 3300046462 Bacteria 1152
116 Ga0495608_0001759 3300046511 Bacteria 15471
117 Ga0495665_0252815 3300046531 Bacteria 907
118 Ga0495667_0206478 3300046559 Bacteria 1256
119 Ga0495624_0236881 3300046690 Bacteria 1105
120 Ga0495604_0084013 3300047317 Bacteria 2378
121 Ga0495674_0291916 3300047319 Bacteria 1333
122 Ga0495602_0203757 3300048088 Bacteria 1507
123 Ga0495602_0641372 3300048088 Bacteria 726
124 Ga0496100_0249297 3300048903 Bacteria 1313
125 Ga0496101_0292484 3300048904 Bacteria 1275
126 Ga0496102_0382135 3300048905 Bacteria 1325
127 Ga0496105_0617884 3300048908 Unclassified 839
128 Ga0496106_0305347 3300048909 Unclassified 1276
129 Ga0496107_0215374 3300048910 Unclassified 1428
130 Ga0496108_0121898 3300048911 Bacteria 2237
131 Ga0496109_0112737 3300048912 Bacteria 2529
132 Ga0496109_0821594 3300048912 Unclassified 867
133 Ga0496111_0447051 3300048914 Bacteria 954
134 Ga0496115_0185622 3300048918 Bacteria 1718
135 Ga0496115_0424004 3300048918 Unclassified 1077
136 Ga0496115_0553048 3300048918 Unclassified 920
137 Ga0501034_0000755 3300049571 Bacteria 48638
138 Ga0501036_0334783 3300049572 Bacteria 1264
139 Ga0501037_0413304 3300049573 Bacteria 924
140 Ga0501038_0186281 3300049574 Bacteria 1672
141 Ga0501039_0246971 3300049575 Bacteria 1403
142 Ga0501040_0226561 3300049576 Bacteria 1330
143 Ga0501041_0124367 3300049577 Bacteria 1604
144 Ga0501042_0229993 3300049578 Bacteria 1337
145 Ga0501043_0633428 3300049579 Bacteria 787
146 Ga0501048_0496026 3300049582 Bacteria 875
147 Ga0501048_0602139 3300049582 Unclassified 789
148 Ga0501068_0192046 3300049584 Bacteria 1293
149 Ga0501069_0169426 3300049585 Bacteria 1259
150 Ga0501071_0260197 3300049587 Bacteria 1310
151 Ga0501071_0282132 3300049587 Bacteria 1257
152 Ga0501071_0404011 3300049587 Bacteria 1043
153 Ga0501071_0565044 3300049587 Unclassified 874
154 Ga0501072_0243507 3300049588 Unclassified 1432
155 Ga0501072_0264959 3300049588 Bacteria 1367
156 Ga0501072_0276058 3300049588 Unclassified 1337
157 Ga0501073_0272455 3300049589 Bacteria 1168
158 Ga0501074_0272357 3300049590 Bacteria 1203
159 Ga0501075_0173137 3300049591 Bacteria 1647
160 Ga0501075_0215799 3300049591 Bacteria 1463
161 Ga0501076_0211805 3300049592 Bacteria 1583
162 Ga0501076_0266375 3300049592 Bacteria 1403
163 Ga0501076_0445810 3300049592 Bacteria 1065
164 Ga0501076_0814076 3300049592 Bacteria 771
165 Ga0501077_0129249 3300049593 Bacteria 1601
166 Ga0501077_0314768 3300049593 Bacteria 998
167 Ga0501079_0248344 3300049741 Bacteria 1390
168 Ga0501079_0267838 3300049741 Bacteria 1335
169 Ga0501079_0574548 3300049741 Bacteria 887
170 Ga0501080_0323156 3300049742 Bacteria 1396
171 Ga0501081_0203977 3300049743 Bacteria 1434
172 Ga0501081_0249516 3300049743 Bacteria 1295
173 Ga0501035_0140638 3300049822 Bacteria 2099
174 Ga0501035_0174911 3300049822 Bacteria 1853
175 Ga0501044_0076197 3300049823 Bacteria 3405
176 Ga0501045_0235967 3300049824 Bacteria 1361
177 nmdc:mga05p37_229418_c1 3300050507 Unclassified 2238
178 nmdc:mga0n895_275043_c1 3300050512 Bacteria 1708
179 Ga0495601_0167671 3300053077 Bacteria 1435
180 Ga0495601_0176161 3300053077 Bacteria 1398
181 Ga0495601_0466168 3300053077 Bacteria 816
182 Ga0495601_0651378 3300053077 Unclassified 674
183 Ga0495595_0091134 3300053084 Bacteria 1462
184 Ga0495595_0175080 3300053084 Bacteria 1063
185 Ga0495619_0055051 3300053085 Bacteria 2634
186 Ga0495619_0317765 3300053085 Unclassified 1078
187 Ga0501084_0179107 3300054114 Bacteria 1789
188 Ga0501082_0337797 3300060353 Bacteria 1312
189 Ga0501082_0365666 3300060353 Bacteria 1258
190 Ga0530510_0149069 3300061734 Bacteria 1726
191 Ga0530510_0402018 3300061734 Bacteria 1032
192 Ga0373953_0236649
193 Ga0070683_100342220
194 Ga0070670_100240251
195 Ga0068869_100637366
196 Ga0070680_100702442
197 Ga0068868_100350535
198 Ga0070714_100330750
199 Ga0070714_100376159
200 Ga0070714_100442065
201 Ga0070713_100400597
202 Ga0070705_100174979
203 Ga0070678_100783894
204 Ga0070681_10280001
205 Ga0070681_10423674
206 Ga0070681_10969128
207 Ga0070679_100332191
208 Ga0070684_100349321
209 Ga0070684_100999207
210 Ga0070695_100169858
211 Ga0070696_100348509
212 Ga0070693_100409011
213 Ga0068855_100353817
214 Ga0068855_100692819
215 Ga0070664_100480534
216 Ga0068857_100286682
217 Ga0068854_100254079
218 Ga0068856_100167198
219 Ga0068852_100454088
220 Ga0068852_100647570
221 Ga0068866_10156529
222 Ga0068860_100443479
223 Ga0081538_10038439
224 Ga0081539_10190493
225 Ga0070717_10342986
226 Ga0097621_100360310
227 Ga0097621_100978639
228 Ga0068871_100302112
229 Ga0068871_100320791
230 Ga0068871_100322727
231 Ga0075429_100471206
232 Ga0105240_10078041
233 Ga0105240_10534533
234 Ga0105240_11187221
235 Ga0105245_10346508
236 Ga0114129_10436277
237 Ga0105242_10185947
238 Ga0105238_10378097
239 Ga0105029_102442
240 Ga0105239_10192693
241 Ga0157370_10547429
242 Ga0157369_10204167
243 Ga0157369_10957038
244 Ga0157378_10426323
245 Ga0157372_10023145
246 Ga0157372_10274107
247 Ga0157372_10454201
248 Ga0157372_11244234
249 Ga0213872_10106895
250 Ga0213874_10039569
251 Ga0224572_1021373
252 Ga0207642_10150601
253 Ga0207663_10659288
254 Ga0207650_10252223
255 Ga0207687_10241517
256 Ga0207700_10674388
257 Ga0207664_10338049
258 Ga0207664_10704422
259 Ga0207689_10311644
260 Ga0207667_10267681
261 Ga0207667_10403903
262 Ga0207667_10832093
263 Ga0207640_10244321
264 Ga0207677_10288337
265 Ga0207702_10147943
266 Ga0207641_10417682
267 Ga0207674_10277946
268 Ga0207698_10060886
269 Ga0207698_10220398
270 Ga0207698_10861948
271 Ga0209971_1042966
272 Ga0209974_10046503
273 Ga0268264_10284562
274 Ga0268264_10690998
275 Ga0265334_10012689
276 Ga0265760_10135517
277 Ga0265331_10268324
278 Ga0265316_10458010
279 Ga0316576_10183524
280 Ga0373955_0095164
281 Ga0373955_0342635
282 Ga0316574_0456115
283 Ga0373935_0240662
284 Ga0373933_0713711
285 Ga0373947_0171884
286 Ga0373937_0422325
287 Ga0373937_0511367
288 Ga0316584_0149842
289 Ga0373925_0281667
290 Ga0395905_0282502
291 Ga0436364_0106491
292 Ga0436364_1095351
293 Ga0400489_29205
294 Ga0436365_0448643
295 Ga0436360_0818206
296 Ga0436361_1012120
297 Ga0436361_1197039
298 Ga0436363_0538718
299 Ga0436363_1237378
300 Ga0436362_1251374
301 Ga0466966_0180602
302 Ga0451576_0479755
303 Ga0466958_0223600
304 Ga0466967_0334737
305 Ga0466967_0487155
306 Ga0495651_0270442
307 Ga0495608_0001759
308 Ga0495665_0252815
309 Ga0495667_0206478
310 Ga0495624_0236881
311 Ga0495604_0084013
312 Ga0495674_0291916
313 Ga0495602_0203757
314 Ga0495602_0641372
315 Ga0496100_0249297
316 Ga0496101_0292484
317 Ga0496102_0382135
318 Ga0496105_0617884
319 Ga0496106_0305347
320 Ga0496107_0215374
321 Ga0496108_0121898
322 Ga0496109_0112737
323 Ga0496109_0821594
324 Ga0496111_0447051
325 Ga0496115_0185622
326 Ga0496115_0424004
327 Ga0496115_0553048
328 Ga0501034_0000755
329 Ga0501036_0334783
330 Ga0501037_0413304
331 Ga0501038_0186281
332 Ga0501039_0246971
333 Ga0501040_0226561
334 Ga0501041_0124367
335 Ga0501042_0229993
336 Ga0501043_0633428
337 Ga0501048_0496026
338 Ga0501048_0602139
339 Ga0501068_0192046
340 Ga0501069_0169426
341 Ga0501071_0260197
342 Ga0501071_0282132
343 Ga0501071_0404011
344 Ga0501071_0565044
345 Ga0501072_0243507
346 Ga0501072_0264959
347 Ga0501072_0276058
348 Ga0501073_0272455
349 Ga0501074_0272357
350 Ga0501075_0173137
351 Ga0501075_0215799
352 Ga0501076_0211805
353 Ga0501076_0266375
354 Ga0501076_0445810
355 Ga0501076_0814076
356 Ga0501077_0129249
357 Ga0501077_0314768
358 Ga0501079_0248344
359 Ga0501079_0267838
360 Ga0501079_0574548
361 Ga0501080_0323156
362 Ga0501081_0203977
363 Ga0501081_0249516
364 Ga0501035_0140638
365 Ga0501035_0174911
366 Ga0501044_0076197
367 Ga0501045_0235967
368 nmdc:mga05p37_229418_c1
369 nmdc:mga0n895_275043_c1
370 Ga0495601_0167671
371 Ga0495601_0176161
372 Ga0495601_0466168
373 Ga0495601_0651378
374 Ga0495595_0091134
375 Ga0495595_0175080
376 Ga0495619_0055051
377 Ga0495619_0317765
378 Ga0501084_0179107
379 Ga0501082_0337797
380 Ga0501082_0365666
381 Ga0530510_0149069
382 Ga0530510_0402018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

55

208

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mda-assembly1.cif.gz_A structure of mos1 transposase catalytic domain and raltegravir with mn 0.7239 17 230
2x6s-assembly1.cif.gz_F human foamy virus integrase - catalytic core. magnesium-bound structure. 0.6988 39 192
4mda-assembly1.cif.gz_A structure of mos1 transposase catalytic domain and raltegravir with mn 0.6926 17 230
2x6n-assembly2.cif.gz_F human foamy virus integrase - catalytic core. manganese-bound structure. 0.6778 39 192
3vq7-assembly1.cif.gz_B hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline 0.6742 39 195
ID Description Score Start End Superfamily
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7621 39 211 3.30.420.10
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7534 32 200 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.691 39 211 3.30.420.10
af_P37007_135_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6827 32 199 3.30.420.10
af_Q09575_838_1038_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6674 32 198 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A535VRX6-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.9661 84 203
AF-A0A6B3MX84-F1-model_v4 IS630 family transposase 0.9629 73 200
AF-A0A326U8B3-F1-model_v4 DDE superfamily endonuclease 0.9602 78 157 GO:0004519
AF-U2BBJ9-F1-model_v4 deleted 0.9577 80 155
AF-A0A5J4S7C8-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.9566 92 162

Map