F294246

General Info

Members Datasets Scaffolds Average Seq Length
191 157 191 150

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100811543|Ga0307408_1008115432
Length 174
Sequence VAGSATEPIRVRPAGVILGGVAVDVVTETVIDRPCAEVAAYAADPSRAPQWYVNIVSVRWLTPPPVRVGSRMAFVARFLGRQLAYTYEIVDLVPGQRLVMRTAQGPFPMETTYTWVAAGDASTRMTLRNRGEPAGFSSLAAPLMVPAMRRANRKDLAKLKRLLEDQPPAIAPIT

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 6.28
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10141666 3300003203 Bacteria 703
2 rootH2_10218813 3300003320 Bacteria 1606
3 rootL2_10169757 3300003322 Bacteria 2084
4 Ga0065715_10017981 3300005293 Bacteria 2986
5 Ga0070658_10170716 3300005327 Unclassified 1827
6 Ga0070676_10031479 3300005328 Unclassified 3032
7 Ga0070676_10225074 3300005328 Bacteria 1241
8 Ga0070683_100048717 3300005329 Bacteria 3917
9 Ga0070690_100150290 3300005330 Bacteria 1588
10 Ga0070690_100627825 3300005330 Bacteria 818
11 Ga0068869_101341490 3300005334 Bacteria 632
12 Ga0070660_100474539 3300005339 Bacteria 1039
13 Ga0070689_100123026 3300005340 Bacteria 2074
14 Ga0070691_10004040 3300005341 Bacteria 6649
15 Ga0070687_100008139 3300005343 Bacteria 4420
16 Ga0070669_100021330 3300005353 Unclassified 4629
17 Ga0070669_101002472 3300005353 Bacteria 717
18 Ga0070671_100135040 3300005355 Bacteria 2079
19 Ga0070674_100460188 3300005356 Unclassified 1052
20 Ga0070673_100014375 3300005364 Bacteria 5510
21 Ga0070673_100342568 3300005364 Bacteria 1325
22 Ga0070688_100093732 3300005365 Bacteria 1967
23 Ga0070667_101791153 3300005367 Bacteria 578
24 Ga0070701_10047331 3300005438 Bacteria 2214
25 Ga0070700_100007814 3300005441 Bacteria 5798
26 Ga0068867_100012701 3300005459 Bacteria 5957
27 Ga0068867_100012794 3300005459 Bacteria 5937
28 Ga0070685_10072799 3300005466 Bacteria 2041
29 Ga0070706_100061735 3300005467 Bacteria 3461
30 Ga0070698_100000318 3300005471 Bacteria 49028
31 Ga0070698_100156578 3300005471 Bacteria 2224
32 Ga0070679_100560444 3300005530 Bacteria 1086
33 Ga0068853_101800783 3300005539 Bacteria 593
34 Ga0070672_100035205 3300005543 Bacteria 3805
35 Ga0070686_101133195 3300005544 Bacteria 647
36 Ga0070695_100133067 3300005545 Bacteria 1716
37 Ga0070696_100041390 3300005546 Unclassified 3183
38 Ga0070693_100631640 3300005547 Bacteria 777
39 Ga0070704_100046604 3300005549 Unclassified 3025
40 Ga0070704_100119750 3300005549 Bacteria 2020
41 Ga0068855_100023165 3300005563 Bacteria 7440
42 Ga0068855_100533301 3300005563 Unclassified 1272
43 Ga0070664_100369283 3300005564 Bacteria 1308
44 Ga0068854_100174663 3300005578 Unclassified 1674
45 Ga0070702_100001800 3300005615 Bacteria 8908
46 Ga0070702_100078189 3300005615 Bacteria 1974
47 Ga0068859_100288393 3300005617 Bacteria 1734
48 Ga0068864_100745664 3300005618 Bacteria 959
49 Ga0068866_10195724 3300005718 Bacteria 1204
50 Ga0068863_100016036 3300005841 Bacteria 7186
51 Ga0068863_100750338 3300005841 Unclassified 972
52 Ga0068858_100160341 3300005842 Bacteria 2117
53 Ga0068858_102044290 3300005842 Bacteria 566
54 Ga0068860_100280961 3300005843 Bacteria 1627
55 Ga0068862_100327983 3300005844 Bacteria 1415
56 Ga0081455_10742655 3300005937 Bacteria 621
57 Ga0081539_10010723 3300005985 Bacteria 7385
58 Ga0081539_10045178 3300005985 Bacteria 2536
59 Ga0068871_101315029 3300006358 Unclassified 680
60 Ga0075428_100582092 3300006844 Bacteria 1196
61 Ga0075434_100213651 3300006871 Bacteria 1949
62 Ga0068865_100103913 3300006881 Bacteria 2084
63 Ga0097620_100288370 3300006931 Bacteria 1734
64 Ga0075435_100001863 3300007076 Bacteria 13704
65 Ga0099794_10034588 3300007265 Bacteria 2382
66 Ga0105240_10328754 3300009093 Unclassified 1740
67 Ga0111539_11984271 3300009094 Unclassified 675
68 Ga0105245_10316631 3300009098 Unclassified 1536
69 Ga0105245_10355385 3300009098 Unclassified 1453
70 Ga0105245_11555589 3300009098 Bacteria 713
71 Ga0114129_11858776 3300009147 Unclassified 731
72 Ga0105243_10022463 3300009148 Unclassified 4795
73 Ga0105242_10270632 3300009176 Unclassified 1539
74 Ga0105248_10090722 3300009177 Bacteria 3441
75 Ga0105248_10236862 3300009177 Bacteria 2055
76 Ga0105248_11200596 3300009177 Bacteria 858
77 Ga0105238_10137648 3300009551 Bacteria 2419
78 Ga0105249_10135447 3300009553 Bacteria 2356
79 Ga0157369_10050516 3300013105 Bacteria 4503
80 Ga0157372_10245968 3300013307 Bacteria 2076
81 Ga0157375_10402066 3300013308 Bacteria 1536
82 Ga0163163_10399482 3300014325 Unclassified 1433
83 Ga0157380_10120384 3300014326 Unclassified 2223
84 Ga0182008_10470137 3300014497 Bacteria 687
85 Ga0206353_10377261 3300020082 Bacteria 3341
86 Ga0207688_10068173 3300025901 Bacteria 2014
87 Ga0207645_10004159 3300025907 Bacteria 10750
88 Ga0207645_10038668 3300025907 Unclassified 3058
89 Ga0207705_10067882 3300025909 Bacteria 2581
90 Ga0207695_11053517 3300025913 Bacteria 693
91 Ga0207662_10005501 3300025918 Bacteria 6762
92 Ga0207681_10096345 3300025923 Unclassified 2124
93 Ga0207681_10872115 3300025923 Bacteria 753
94 Ga0207687_10898399 3300025927 Bacteria 758
95 Ga0207644_10199278 3300025931 Bacteria 1578
96 Ga0207686_10296323 3300025934 Bacteria 1200
97 Ga0207709_10022327 3300025935 Unclassified 3589
98 Ga0207670_10181821 3300025936 Bacteria 1584
99 Ga0207670_10696403 3300025936 Bacteria 841
100 Ga0207669_10305667 3300025937 Unclassified 1211
101 Ga0207704_10104705 3300025938 Bacteria 1896
102 Ga0207691_10016657 3300025940 Bacteria 6980
103 Ga0207711_10032172 3300025941 Bacteria 4434
104 Ga0207711_10929413 3300025941 Bacteria 808
105 Ga0207711_11310258 3300025941 Bacteria 666
106 Ga0207679_11535795 3300025945 Bacteria 610
107 Ga0207667_10863161 3300025949 Bacteria 899
108 Ga0207651_10010103 3300025960 Bacteria 5210
109 Ga0207640_10099876 3300025981 Unclassified 2032
110 Ga0207640_11801242 3300025981 Unclassified 553
111 Ga0207658_10181314 3300025986 Bacteria 1743
112 Ga0207703_10840784 3300026035 Bacteria 877
113 Ga0207639_10124840 3300026041 Bacteria 2121
114 Ga0207708_10065002 3300026075 Unclassified 2788
115 Ga0207641_10026901 3300026088 Bacteria 4750
116 Ga0207648_10007122 3300026089 Bacteria 11032
117 Ga0207648_10136882 3300026089 Unclassified 2157
118 Ga0207676_10581273 3300026095 Bacteria 1074
119 Ga0207675_100319741 3300026118 Bacteria 1515
120 Ga0207683_10088304 3300026121 Bacteria 2758
121 Ga0207698_10036538 3300026142 Bacteria 3607
122 Ga0209588_1023435 3300027671 Bacteria 1945
123 Ga0268266_10978568 3300028379 Bacteria 819
124 Ga0268265_10500120 3300028380 Bacteria 1145
125 Ga0268264_10402080 3300028381 Bacteria 1316
126 Ga0307408_100445752 3300031548 Bacteria 1122
127 Ga0307408_100811543 3300031548 Bacteria 850
128 Ga0307508_10186754 3300031616 Bacteria 1675
129 Ga0307405_10045573 3300031731 Bacteria 2689
130 Ga0307405_11225481 3300031731 Bacteria 650
131 Ga0307413_10223949 3300031824 Bacteria 1376
132 Ga0307413_10613868 3300031824 Bacteria 892
133 Ga0307410_10378001 3300031852 Bacteria 1139
134 Ga0307410_11084764 3300031852 Unclassified 693
135 Ga0307406_10187855 3300031901 Bacteria 1510
136 Ga0307409_100052815 3300031995 Bacteria 3118
137 Ga0307416_100688668 3300032002 Bacteria 1110
138 Ga0307414_10248597 3300032004 Bacteria 1477
139 Ga0307411_10436808 3300032005 Bacteria 1091
140 Ga0307415_100041240 3300032126 Bacteria 3063
141 Ga0307415_100286791 3300032126 Bacteria 1357
142 Ga0307415_101410576 3300032126 Bacteria 663
143 Ga0373938_0069841 3300034957 Bacteria 838
144 Ga0373940_0042306 3300035088 Bacteria 1255
145 Ga0373939_0110954 3300035114 Bacteria 955
146 Ga0373941_0015781 3300035115 Bacteria 2043
147 Ga0373956_0003448 3300035119 Bacteria 6370
148 Ga0373960_0010634 3300035121 Bacteria 2252
149 Ga0373942_0000140 3300035207 Bacteria 17260
150 Ga0373961_0148798 3300035241 Bacteria 796
151 Ga0373947_0964716 3300035725 Bacteria 582
152 Ga0395901_0165269 3300038443 Bacteria 2324
153 Ga0439439_0028638 3300041406 Bacteria 1412
154 Ga0451807_0429616 3300041486 Bacteria 3876
155 Ga0439452_024337 3300042010 Bacteria 1549
156 Ga0439446_0073038 3300042156 Bacteria 1052
157 Ga0439440_0237760 3300042993 Bacteria 551
158 Ga0466966_0058631 3300044684 Bacteria 2433
159 Ga0466968_0005914 3300044735 Bacteria 4590
160 Ga0495603_0084915 3300046455 Bacteria 1854
161 Ga0495629_0132139 3300046459 Unclassified 1739
162 Ga0495618_0411842 3300046514 Unclassified 825
163 Ga0495628_0043298 3300046516 Bacteria 3587
164 Ga0495634_0134582 3300046642 Unclassified 1573
165 Ga0495635_0409288 3300046663 Unclassified 900
166 Ga0495658_0073475 3300046683 Bacteria 1991
167 Ga0495613_0056505 3300046689 Bacteria 2882
168 Ga0496100_0113175 3300048903 Bacteria 1888
169 Ga0496101_0016865 3300048904 Bacteria 4944
170 Ga0496103_0029978 3300048906 Bacteria 3308
171 Ga0496103_0089575 3300048906 Bacteria 1941
172 Ga0496106_0006931 3300048909 Bacteria 8380
173 Ga0496106_0099016 3300048909 Bacteria 2260
174 Ga0496106_0181723 3300048909 Unclassified 1670
175 Ga0496107_0005750 3300048910 Bacteria 8483
176 Ga0496107_0254238 3300048910 Bacteria 1307
177 Ga0496113_0130215 3300048916 Bacteria 1974
178 Ga0496115_0060443 3300048918 Bacteria 3053
179 Ga0501221_085974 3300049704 Unclassified 763
180 Ga0501225_0266832 3300049705 Unclassified 569
181 Ga0501283_026448 3300049779 Bacteria 955
182 nmdc:mga00v17_358505_c1 3300050491 Bacteria 948
183 nmdc:mga09592_761700_c1 3300050508 Bacteria 821
184 nmdc:mga08y16_1781794_c1 3300050511 Unclassified 569
185 nmdc:mga0rr50_38419_c1 3300050513 Bacteria 3464
186 nmdc:mga08x19_1324743_c1 3300050514 Bacteria 510
187 nmdc:mga08x19_422370_c1 3300050514 Bacteria 936
188 Ga0495601_0000138 3300053077 Bacteria 41055
189 Ga0495612_0017713 3300053078 Bacteria 2852
190 Ga0590075_044148 3300059424 Bacteria 1141
191 Ga0530510_0507813 3300061734 Bacteria 914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0964716 Ga0373947_0964716_129_566 145
2 3300044684 Ga0466966_0058631 Ga0466966_0058631_1015_1452 145
3 3300050491 nmdc:mga00v17_358505_c1 nmdc:mga00v17_358505_c1_497_934 145
4 3300050514 nmdc:mga08x19_422370_c1 nmdc:mga08x19_422370_c1_395_832 145
5 3300003320 rootH2_10218813 rootH2_102188132 146
6 3300005339 Ga0070660_100474539 Ga0070660_1004745392 146
7 3300005563 Ga0068855_100023165 Ga0068855_1000231652 146
8 3300005937 Ga0081455_10742655 Ga0081455_107426551 146
9 3300025949 Ga0207667_10863161 Ga0207667_108631612 146
10 3300025981 Ga0207640_11801242 Ga0207640_118012421 146
11 3300031901 Ga0307406_10187855 Ga0307406_101878553 146
12 3300032002 Ga0307416_100688668 Ga0307416_1006886682 146
13 3300041486 Ga0451807_0429616 Ga0451807_0429616_44_484 146
14 3300046459 Ga0495629_0132139 Ga0495629_0132139_930_1370 146
15 3300046514 Ga0495618_0411842 Ga0495618_0411842_335_775 146
16 3300046516 Ga0495628_0043298 Ga0495628_0043298_1231_1671 146
17 3300046642 Ga0495634_0134582 Ga0495634_0134582_394_834 146
18 3300046663 Ga0495635_0409288 Ga0495635_0409288_293_733 146
19 3300046683 Ga0495658_0073475 Ga0495658_0073475_138_578 146
20 3300046689 Ga0495613_0056505 Ga0495613_0056505_2085_2525 146
21 3300049704 Ga0501221_085974 Ga0501221_085974_163_603 146
22 3300049779 Ga0501283_026448 Ga0501283_026448_43_483 146
23 3300053077 Ga0495601_0000138 Ga0495601_0000138_11545_11985 146
24 3300053078 Ga0495612_0017713 Ga0495612_0017713_273_713 146
25 3300059424 Ga0590075_044148 Ga0590075_044148_619_1062 146
26 3300005467 Ga0070706_100061735 Ga0070706_1000617355 147
27 3300005471 Ga0070698_100000318 Ga0070698_10000031810 147
28 3300005471 Ga0070698_100156578 Ga0070698_1001565782 147
29 3300006844 Ga0075428_100582092 Ga0075428_1005820922 147
30 3300009094 Ga0111539_11984271 Ga0111539_119842711 147
31 3300009147 Ga0114129_11858776 Ga0114129_118587761 147
32 3300014497 Ga0182008_10470137 Ga0182008_104701371 147
33 3300028379 Ga0268266_10978568 Ga0268266_109785681 147
34 3300031616 Ga0307508_10186754 Ga0307508_101867542 147
35 3300031824 Ga0307413_10223949 Ga0307413_102239493 147
36 3300032005 Ga0307411_10436808 Ga0307411_104368082 147
37 3300032126 Ga0307415_100041240 Ga0307415_1000412404 147
38 3300032126 Ga0307415_100286791 Ga0307415_1002867912 147
39 3300034957 Ga0373938_0069841 Ga0373938_0069841_250_693 147
40 3300035088 Ga0373940_0042306 Ga0373940_0042306_792_1235 147
41 3300035115 Ga0373941_0015781 Ga0373941_0015781_1253_1696 147
42 3300035207 Ga0373942_0000140 Ga0373942_0000140_12553_12996 147
43 3300038443 Ga0395901_0165269 Ga0395901_0165269_1052_1510 147
44 3300049705 Ga0501225_0266832 Ga0501225_0266832_100_543 147
45 3300050511 nmdc:mga08y16_1781794_c1 nmdc:mga08y16_1781794_c1_62_505 147
46 3300005293 Ga0065715_10017981 Ga0065715_100179812 148
47 3300005328 Ga0070676_10225074 Ga0070676_102250741 148
48 3300005330 Ga0070690_100150290 Ga0070690_1001502902 148
49 3300005340 Ga0070689_100123026 Ga0070689_1001230261 148
50 3300005343 Ga0070687_100008139 Ga0070687_1000081398 148
51 3300005353 Ga0070669_101002472 Ga0070669_1010024722 148
52 3300005355 Ga0070671_100135040 Ga0070671_1001350402 148
53 3300005364 Ga0070673_100014375 Ga0070673_1000143754 148
54 3300005365 Ga0070688_100093732 Ga0070688_1000937322 148
55 3300005367 Ga0070667_101791153 Ga0070667_1017911531 148
56 3300005438 Ga0070701_10047331 Ga0070701_100473312 148
57 3300005459 Ga0068867_100012701 Ga0068867_1000127017 148
58 3300005466 Ga0070685_10072799 Ga0070685_100727992 148
59 3300005543 Ga0070672_100035205 Ga0070672_1000352053 148
60 3300005545 Ga0070695_100133067 Ga0070695_1001330671 148
61 3300005547 Ga0070693_100631640 Ga0070693_1006316401 148
62 3300005549 Ga0070704_100119750 Ga0070704_1001197504 148
63 3300005615 Ga0070702_100078189 Ga0070702_1000781892 148
64 3300005718 Ga0068866_10195724 Ga0068866_101957242 148
65 3300005841 Ga0068863_100016036 Ga0068863_1000160367 148
66 3300005841 Ga0068863_100750338 Ga0068863_1007503381 148
67 3300005842 Ga0068858_100160341 Ga0068858_1001603413 148
68 3300005842 Ga0068858_102044290 Ga0068858_1020442901 148
69 3300005843 Ga0068860_100280961 Ga0068860_1002809611 148
70 3300005844 Ga0068862_100327983 Ga0068862_1003279832 148
71 3300006871 Ga0075434_100213651 Ga0075434_1002136512 148
72 3300006881 Ga0068865_100103913 Ga0068865_1001039133 148
73 3300007076 Ga0075435_100001863 Ga0075435_1000018633 148
74 3300007265 Ga0099794_10034588 Ga0099794_100345882 148
75 3300009177 Ga0105248_10236862 Ga0105248_102368623 148
76 3300009553 Ga0105249_10135447 Ga0105249_101354472 148
77 3300014325 Ga0163163_10399482 Ga0163163_103994822 148
78 3300025901 Ga0207688_10068173 Ga0207688_100681734 148
79 3300025907 Ga0207645_10004159 Ga0207645_100041592 148
80 3300025918 Ga0207662_10005501 Ga0207662_100055012 148
81 3300025923 Ga0207681_10872115 Ga0207681_108721152 148
82 3300025931 Ga0207644_10199278 Ga0207644_101992782 148
83 3300025934 Ga0207686_10296323 Ga0207686_102963232 148
84 3300025936 Ga0207670_10181821 Ga0207670_101818213 148
85 3300025938 Ga0207704_10104705 Ga0207704_101047052 148
86 3300025940 Ga0207691_10016657 Ga0207691_100166576 148
87 3300025941 Ga0207711_10032172 Ga0207711_100321723 148
88 3300025960 Ga0207651_10010103 Ga0207651_100101034 148
89 3300026035 Ga0207703_10840784 Ga0207703_108407842 148
90 3300026088 Ga0207641_10026901 Ga0207641_100269012 148
91 3300026089 Ga0207648_10007122 Ga0207648_100071228 148
92 3300026095 Ga0207676_10581273 Ga0207676_105812732 148
93 3300026118 Ga0207675_100319741 Ga0207675_1003197411 148
94 3300026121 Ga0207683_10088304 Ga0207683_100883042 148
95 3300027671 Ga0209588_1023435 Ga0209588_10234352 148
96 3300028380 Ga0268265_10500120 Ga0268265_105001202 148
97 3300028381 Ga0268264_10402080 Ga0268264_104020802 148
98 3300031548 Ga0307408_100445752 Ga0307408_1004457522 148
99 3300031731 Ga0307405_11225481 Ga0307405_112254812 148
100 3300032126 Ga0307415_101410576 Ga0307415_1014105762 148
101 3300035114 Ga0373939_0110954 Ga0373939_0110954_69_515 148
102 3300035121 Ga0373960_0010634 Ga0373960_0010634_678_1124 148
103 3300035241 Ga0373961_0148798 Ga0373961_0148798_282_728 148
104 3300041406 Ga0439439_0028638 Ga0439439_0028638_16_462 148
105 3300042010 Ga0439452_024337 Ga0439452_024337_1031_1477 148
106 3300042156 Ga0439446_0073038 Ga0439446_0073038_560_1006 148
107 3300048906 Ga0496103_0089575 Ga0496103_0089575_1343_1789 148
108 3300048909 Ga0496106_0099016 Ga0496106_0099016_221_667 148
109 3300048910 Ga0496107_0254238 Ga0496107_0254238_329_775 148
110 3300048916 Ga0496113_0130215 Ga0496113_0130215_315_761 148
111 3300050508 nmdc:mga09592_761700_c1 nmdc:mga09592_761700_c1_31_477 148
112 3300050513 nmdc:mga0rr50_38419_c1 nmdc:mga0rr50_38419_c1_1447_1893 148
113 3300050514 nmdc:mga08x19_1324743_c1 nmdc:mga08x19_1324743_c1_22_468 148
114 3300061734 Ga0530510_0507813 Ga0530510_0507813_208_654 148
115 3300003203 JGI25406J46586_10141666 JGI25406J46586_101416661 149
116 3300003322 rootL2_10169757 rootL2_101697572 149
117 3300005327 Ga0070658_10170716 Ga0070658_101707163 149
118 3300005328 Ga0070676_10031479 Ga0070676_100314794 149
119 3300005329 Ga0070683_100048717 Ga0070683_1000487175 149
120 3300005330 Ga0070690_100627825 Ga0070690_1006278251 149
121 3300005334 Ga0068869_101341490 Ga0068869_1013414902 149
122 3300005341 Ga0070691_10004040 Ga0070691_100040407 149
123 3300005353 Ga0070669_100021330 Ga0070669_1000213302 149
124 3300005356 Ga0070674_100460188 Ga0070674_1004601881 149
125 3300005364 Ga0070673_100342568 Ga0070673_1003425684 149
126 3300005441 Ga0070700_100007814 Ga0070700_1000078144 149
127 3300005459 Ga0068867_100012794 Ga0068867_1000127946 149
128 3300005530 Ga0070679_100560444 Ga0070679_1005604441 149
129 3300005539 Ga0068853_101800783 Ga0068853_1018007831 149
130 3300005544 Ga0070686_101133195 Ga0070686_1011331951 149
131 3300005546 Ga0070696_100041390 Ga0070696_1000413904 149
132 3300005549 Ga0070704_100046604 Ga0070704_1000466041 149
133 3300005563 Ga0068855_100533301 Ga0068855_1005333011 149
134 3300005564 Ga0070664_100369283 Ga0070664_1003692832 149
135 3300005578 Ga0068854_100174663 Ga0068854_1001746632 149
136 3300005615 Ga0070702_100001800 Ga0070702_1000018006 149
137 3300005617 Ga0068859_100288393 Ga0068859_1002883934 149
138 3300005618 Ga0068864_100745664 Ga0068864_1007456642 149
139 3300005985 Ga0081539_10010723 Ga0081539_100107236 149
140 3300005985 Ga0081539_10045178 Ga0081539_100451783 149
141 3300006358 Ga0068871_101315029 Ga0068871_1013150291 149
142 3300006931 Ga0097620_100288370 Ga0097620_1002883701 149
143 3300009093 Ga0105240_10328754 Ga0105240_103287542 149
144 3300009098 Ga0105245_10316631 Ga0105245_103166312 149
145 3300009098 Ga0105245_10355385 Ga0105245_103553851 149
146 3300009098 Ga0105245_11555589 Ga0105245_115555891 149
147 3300009148 Ga0105243_10022463 Ga0105243_100224632 149
148 3300009176 Ga0105242_10270632 Ga0105242_102706321 149
149 3300009177 Ga0105248_10090722 Ga0105248_100907224 149
150 3300009177 Ga0105248_11200596 Ga0105248_112005962 149
151 3300009551 Ga0105238_10137648 Ga0105238_101376482 149
152 3300013105 Ga0157369_10050516 Ga0157369_100505165 149
153 3300013307 Ga0157372_10245968 Ga0157372_102459683 149
154 3300013308 Ga0157375_10402066 Ga0157375_104020664 149
155 3300014326 Ga0157380_10120384 Ga0157380_101203843 149
156 3300020082 Ga0206353_10377261 Ga0206353_103772613 149
157 3300025907 Ga0207645_10038668 Ga0207645_100386682 149
158 3300025909 Ga0207705_10067882 Ga0207705_100678823 149
159 3300025913 Ga0207695_11053517 Ga0207695_110535172 149
160 3300025923 Ga0207681_10096345 Ga0207681_100963452 149
161 3300025927 Ga0207687_10898399 Ga0207687_108983992 149
162 3300025935 Ga0207709_10022327 Ga0207709_100223274 149
163 3300025936 Ga0207670_10696403 Ga0207670_106964032 149
164 3300025937 Ga0207669_10305667 Ga0207669_103056671 149
165 3300025941 Ga0207711_10929413 Ga0207711_109294132 149
166 3300025941 Ga0207711_11310258 Ga0207711_113102581 149
167 3300025945 Ga0207679_11535795 Ga0207679_115357952 149
168 3300025981 Ga0207640_10099876 Ga0207640_100998761 149
169 3300025986 Ga0207658_10181314 Ga0207658_101813143 149
170 3300026041 Ga0207639_10124840 Ga0207639_101248403 149
171 3300026075 Ga0207708_10065002 Ga0207708_100650023 149
172 3300026089 Ga0207648_10136882 Ga0207648_101368821 149
173 3300026142 Ga0207698_10036538 Ga0207698_100365381 149
174 3300031548 Ga0307408_100811543 Ga0307408_1008115432 149
175 3300031731 Ga0307405_10045573 Ga0307405_100455733 149
176 3300031824 Ga0307413_10613868 Ga0307413_106138682 149
177 3300031852 Ga0307410_10378001 Ga0307410_103780012 149
178 3300031852 Ga0307410_11084764 Ga0307410_110847641 149
179 3300031995 Ga0307409_100052815 Ga0307409_1000528152 149
180 3300032004 Ga0307414_10248597 Ga0307414_102485972 149
181 3300035119 Ga0373956_0003448 Ga0373956_0003448_571_1020 149
182 3300042993 Ga0439440_0237760 Ga0439440_0237760_32_490 149
183 3300044735 Ga0466968_0005914 Ga0466968_0005914_3426_3884 149
184 3300046455 Ga0495603_0084915 Ga0495603_0084915_1173_1622 149
185 3300048903 Ga0496100_0113175 Ga0496100_0113175_22_492 149
186 3300048904 Ga0496101_0016865 Ga0496101_0016865_1283_1786 149
187 3300048906 Ga0496103_0029978 Ga0496103_0029978_450_953 149
188 3300048909 Ga0496106_0006931 Ga0496106_0006931_2701_3204 149
189 3300048909 Ga0496106_0181723 Ga0496106_0181723_474_941 149
190 3300048910 Ga0496107_0005750 Ga0496107_0005750_7755_8258 149
191 3300048918 Ga0496115_0060443 Ga0496115_0060443_287_790 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

22

164

0.87

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

32

164

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.8832 2 145
4jda-assembly1.cif.gz_B complex structure of abscisic acid receptor pyl3 with (-)-aba 0.8713 2 140
3nj0-assembly1.cif.gz_A x-ray crystal structure of the pyl2-pyrabactin a complex 0.871 2 141
4oic-assembly1.cif.gz_A crystal structrual of a soluble protein 0.8695 1 147
3kl1-assembly1.cif.gz_B crystal structure of abscisic acid receptor pyl2 at 1.55 a 0.8681 2 141
ID Description Score Start End Superfamily
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8692 2 139 3.30.530.20
af_Q7XBY6_2_207_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8676 2 146 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8662 4 146 3.30.530.20
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8648 1 146 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8619 5 145 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N0DTW4-F1-model_v4 ATPase 0.9778 1 144
AF-A0A4P5W861-F1-model_v4 ATPase 0.9763 2 144
AF-A0A2A3FVB7-F1-model_v4 ATPase 0.9708 2 145
AF-A0A1V9G6T5-F1-model_v4 Polyketide cyclase 0.9706 3 146
AF-A0A7W0LUD5-F1-model_v4 SRPBCC family protein 0.9669 4 145

Feature Viewer

pLDDT pTM Quality
91.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map