F294227

General Info

Members Datasets Scaffolds Average Seq Length
191 85 191 173

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10065200|Ga0265320_100652002
Length 198
Sequence MFFLDYYRDSETEKKPMYGQGIWKGLKVTLTRFLQTYQSDLSWLLRGQKRYYSPEGIAYRSGKDNNGIFTIQYPEEDLPIPEEFRYVPFLVFDQKENGEKDVRCTSCGICAKVCPPQCIWIVRTSDPETGRPIPVPTEFYIDADVIMDHNYELASEHRNLLNMEQLLKPADYYRKIRPQNYAIQEAERQAKEKADAQQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3729193 2162886007 Bacteria 4371
2 JGI25406J46586_10010267 3300003203 Bacteria 4160
3 Ga0065704_10000566 3300005289 Bacteria 25698
4 Ga0065704_10371875 3300005289 Bacteria 784
5 Ga0065707_10082660 3300005295 Bacteria 12928
6 Ga0065707_10083881 3300005295 Bacteria 8046
7 Ga0065707_10177891 3300005295 Bacteria 1438
8 Ga0070689_100258486 3300005340 Unclassified 1439
9 Ga0070705_100106384 3300005440 Bacteria 1783
10 Ga0070705_100359433 3300005440 Bacteria 1064
11 Ga0070700_100038011 3300005441 Bacteria 2931
12 Ga0070694_100058948 3300005444 Bacteria 2613
13 Ga0070706_100287965 3300005467 Bacteria 1533
14 Ga0070707_100888000 3300005468 Bacteria 856
15 Ga0070698_100097389 3300005471 Bacteria 2917
16 Ga0070698_100710332 3300005471 Unclassified 947
17 Ga0070699_100152682 3300005518 Bacteria 2043
18 Ga0070699_100276798 3300005518 Bacteria 1503
19 Ga0070699_100657958 3300005518 Unclassified 956
20 Ga0070699_100666120 3300005518 Bacteria 950
21 Ga0070699_100764789 3300005518 Bacteria 884
22 Ga0070697_100157126 3300005536 Bacteria 1920
23 Ga0070697_100236338 3300005536 Bacteria 1560
24 Ga0070697_100779033 3300005536 Bacteria 846
25 Ga0070695_100028268 3300005545 Bacteria 3479
26 Ga0070695_100180889 3300005545 Bacteria 1494
27 Ga0070696_100118621 3300005546 Bacteria 1913
28 Ga0070696_100201835 3300005546 Bacteria 1485
29 Ga0070704_100021038 3300005549 Bacteria 4221
30 Ga0070704_100272282 3300005549 Bacteria 1399
31 Ga0070704_100441270 3300005549 Bacteria 1119
32 Ga0070704_101031652 3300005549 Bacteria 745
33 Ga0068857_100049592 3300005577 Bacteria 3724
34 Ga0068857_100203035 3300005577 Unclassified 1807
35 Ga0068859_100041320 3300005617 Bacteria 4631
36 Ga0068859_100190809 3300005617 Bacteria 2133
37 Ga0068870_10109452 3300005840 Bacteria 1575
38 Ga0068862_100031716 3300005844 Bacteria 4463
39 Ga0068862_100415322 3300005844 Bacteria 1261
40 Ga0081539_10006020 3300005985 Bacteria 11907
41 Ga0075427_10001233 3300006194 Unclassified 3257
42 Ga0075428_100056888 3300006844 Bacteria 4282
43 Ga0075428_100387874 3300006844 Archaea 1497
44 Ga0075430_100057689 3300006846 Bacteria 3265
45 Ga0075431_100037168 3300006847 Bacteria 5018
46 Ga0075431_100152227 3300006847 Bacteria 2382
47 Ga0075434_100417924 3300006871 Unclassified 1362
48 Ga0075429_100024929 3300006880 Bacteria 5192
49 Ga0075429_100025143 3300006880 Bacteria 5169
50 Ga0075429_100203932 3300006880 Bacteria 1733
51 Ga0075429_100281134 3300006880 Archaea 1457
52 Ga0075429_100299647 3300006880 Bacteria 1407
53 Ga0075429_100321629 3300006880 Archaea 1354
54 Ga0097620_100041320 3300006931 Bacteria 4631
55 Ga0097620_100190800 3300006931 Bacteria 2133
56 Ga0111539_10772140 3300009094 Bacteria 1118
57 Ga0114129_10009582 3300009147 Bacteria 13816
58 Ga0114129_10032841 3300009147 Bacteria 7333
59 Ga0114129_10125125 3300009147 Bacteria 3535
60 Ga0114129_10144754 3300009147 Bacteria 3256
61 Ga0114129_10156014 3300009147 Archaea 3121
62 Ga0114129_10568405 3300009147 Unclassified 1472
63 Ga0105243_10099011 3300009148 Bacteria 2416
64 Ga0105243_10148087 3300009148 Unclassified 2011
65 Ga0105243_10148490 3300009148 Bacteria 2008
66 Ga0105241_10767635 3300009174 Bacteria 885
67 Ga0105242_10387929 3300009176 Unclassified 1300
68 Ga0105249_10119333 3300009553 Bacteria 2504
69 Ga0105249_10568672 3300009553 Bacteria 1186
70 Ga0157380_10108143 3300014326 Unclassified 2330
71 Ga0207653_10165299 3300025885 Bacteria 821
72 Ga0207643_10101049 3300025908 Unclassified 1691
73 Ga0207684_10531500 3300025910 Bacteria 1007
74 Ga0207646_10158174 3300025922 Bacteria 2044
75 Ga0207646_10628452 3300025922 Bacteria 963
76 Ga0207709_10061423 3300025935 Unclassified 2348
77 Ga0207709_10081025 3300025935 Bacteria 2092
78 Ga0207712_10428929 3300025961 Bacteria 1117
79 Ga0207708_10042200 3300026075 Bacteria 3478
80 Ga0207676_10324879 3300026095 Bacteria 1414
81 Ga0207676_11206097 3300026095 Bacteria 750
82 Ga0207674_10303193 3300026116 Bacteria 1546
83 Ga0207674_10305065 3300026116 Bacteria 1541
84 Ga0207675_100175452 3300026118 Bacteria 2050
85 Ga0268265_11260241 3300028380 Bacteria 738
86 Ga0265318_10027832 3300028577 Bacteria 2217
87 Ga0265323_10045831 3300028653 Unclassified 1570
88 Ga0265320_10065200 3300031240 Bacteria 1729
89 Ga0265340_10064329 3300031247 Bacteria 1748
90 Ga0265327_10013384 3300031251 Bacteria 5450
91 Ga0316575_10058071 3300031665 Unclassified 1543
92 Ga0316575_10100266 3300031665 Bacteria 1177
93 Ga0316578_10281895 3300031728 Unclassified 995
94 Ga0316578_10350092 3300031728 Bacteria 879
95 Ga0307405_10089992 3300031731 Bacteria 2029
96 Ga0307413_10139752 3300031824 Bacteria 1671
97 Ga0307413_10376528 3300031824 Bacteria 1104
98 Ga0307410_10178246 3300031852 Bacteria 1607
99 Ga0307409_100150425 3300031995 Bacteria 2020
100 Ga0307416_100086377 3300032002 Bacteria 2674
101 Ga0307411_10830482 3300032005 Unclassified 816
102 Ga0307415_100040832 3300032126 Bacteria 3077
103 Ga0307415_100540750 3300032126 Bacteria 1026
104 Ga0316574_0339536 3300035398 Bacteria 952
105 Ga0316582_0097220 3300036647 Bacteria 1945
106 Ga0316582_0141535 3300036647 Bacteria 1622
107 Ga0316584_0031634 3300036712 Bacteria 3913
108 Ga0316581_0090151 3300037588 Unclassified 944
109 Ga0400489_42137 3300039093 Bacteria 4046
110 Ga0451577_0003960 3300042876 Bacteria 15976
111 Ga0451577_0010457 3300042876 Bacteria 8866
112 Ga0451577_0030948 3300042876 Unclassified 4832
113 Ga0451577_0079777 3300042876 Bacteria 2918
114 Ga0451577_0169935 3300042876 Unclassified 1964
115 Ga0451577_0265702 3300042876 Bacteria 1553
116 Ga0451577_0327644 3300042876 Bacteria 1389
117 Ga0451577_0543136 3300042876 Bacteria 1055
118 Ga0451577_0957097 3300042876 Bacteria 770
119 Ga0453683_0004454 3300044673 Bacteria 9933
120 Ga0453683_0024260 3300044673 Bacteria 3860
121 Ga0453683_0155538 3300044673 Bacteria 1445
122 Ga0453683_0462987 3300044673 Bacteria 821
123 Ga0453684_0000003 3300044712 Bacteria 1481694
124 Ga0453684_0000044 3300044712 Bacteria 585643
125 Ga0453684_0000415 3300044712 Bacteria 174067
126 Ga0453684_0000430 3300044712 Bacteria 171415
127 Ga0453684_0005462 3300044712 Bacteria 25166
128 Ga0453684_0007294 3300044712 Bacteria 20459
129 Ga0453684_0010082 3300044712 Bacteria 16235
130 Ga0453684_0010741 3300044712 Bacteria 15555
131 Ga0453684_0017427 3300044712 Bacteria 11127
132 Ga0453684_0030986 3300044712 Bacteria 7536
133 Ga0453684_0044768 3300044712 Bacteria 5915
134 Ga0453684_0055145 3300044712 Bacteria 5169
135 Ga0453684_0075321 3300044712 Bacteria 4243
136 Ga0453684_0110568 3300044712 Bacteria 3339
137 Ga0453684_0113416 3300044712 Bacteria 3288
138 Ga0453684_0119346 3300044712 Bacteria 3187
139 Ga0453684_0164723 3300044712 Bacteria 2618
140 Ga0453684_0215189 3300044712 Bacteria 2230
141 Ga0453684_0384231 3300044712 Bacteria 1576
142 Ga0453684_0450751 3300044712 Bacteria 1432
143 Ga0453684_0477088 3300044712 Bacteria 1384
144 Ga0453684_0749601 3300044712 Unclassified 1057
145 Ga0453684_0790019 3300044712 Unclassified 1024
146 Ga0453684_0942583 3300044712 Unclassified 922
147 Ga0453684_1076119 3300044712 Unclassified 851
148 Ga0453684_1328933 3300044712 Bacteria 749
149 Ga0451576_0004702 3300045051 Bacteria 17561
150 Ga0451576_0040313 3300045051 Bacteria 4944
151 Ga0451576_0060492 3300045051 Unclassified 3951
152 Ga0451576_0082935 3300045051 Bacteria 3335
153 Ga0451576_0107241 3300045051 Unclassified 2906
154 Ga0451576_0190431 3300045051 Unclassified 2142
155 Ga0451576_0222130 3300045051 Bacteria 1972
156 Ga0451576_0418287 3300045051 Unclassified 1406
157 Ga0501031_0418153 3300049568 Unclassified 867
158 Ga0501071_0290200 3300049587 Bacteria 1239
159 Ga0501072_0282285 3300049588 Bacteria 1321
160 Ga0501075_0043505 3300049591 Bacteria 3368
161 Ga0501076_0040231 3300049592 Bacteria 3673
162 Ga0501079_0091341 3300049741 Bacteria 2359
163 Ga0501079_0111916 3300049741 Bacteria 2122
164 Ga0501080_0045517 3300049742 Bacteria 4085
165 nmdc:mga05p37_108156_c1 3300050507 Unclassified 3421
166 nmdc:mga05p37_108613_c1 3300050507 Bacteria 3413
167 nmdc:mga05p37_241829_c1 3300050507 Bacteria 2170
168 nmdc:mga05p37_364495_c1 3300050507 Bacteria 1698
169 nmdc:mga05p37_542245_c1 3300050507 Bacteria 1326
170 nmdc:mga05p37_6775_c1 3300050507 Bacteria 13503
171 nmdc:mga05p37_69163_c1 3300050507 Bacteria 4343
172 nmdc:mga09592_130701_c1 3300050508 Unclassified 2160
173 nmdc:mga09592_144893_c1 3300050508 Bacteria 2048
174 nmdc:mga09592_149244_c1 3300050508 Unclassified 2016
175 nmdc:mga09592_17976_c1 3300050508 Bacteria 5794
176 nmdc:mga09592_18296_c2 3300050508 Bacteria 3712
177 nmdc:mga09592_232275_c1 3300050508 Unclassified 1598
178 nmdc:mga09592_52551_c1 3300050508 Bacteria 3439
179 nmdc:mga0qj67_163396_c1 3300050509 Archaea 1807
180 nmdc:mga0qj67_82536_c1 3300050509 Bacteria 2577
181 nmdc:mga06r32_808220_c1 3300050510 Archaea 898
182 nmdc:mga06r32_88379_c1 3300050510 Archaea 3025
183 nmdc:mga08y16_212089_c1 3300050511 Bacteria 2005
184 nmdc:mga08y16_712539_c1 3300050511 Bacteria 1002
185 nmdc:mga0n895_129472_c1 3300050512 Bacteria 2548
186 nmdc:mga0n895_211949_c1 3300050512 Unclassified 1967
187 nmdc:mga0a205_31346_c1 3300050515 Bacteria 5094
188 nmdc:mga0a205_494867_c1 3300050515 Bacteria 1080
189 Ga0501084_0486806 3300054114 Bacteria 1043
190 Ga0501082_0378442 3300060353 Bacteria 1235
191 Ga0501082_0661741 3300060353 Bacteria 914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10281895 Ga0316578_102818952 155
2 3300042876 Ga0451577_0003960 Ga0451577_0003960_12009_12626 160
3 3300044712 Ga0453684_0007294 Ga0453684_0007294_16384_17001 160
4 3300036647 Ga0316582_0141535 Ga0316582_0141535_837_1448 162
5 3300044712 Ga0453684_0749601 Ga0453684_0749601_390_932 163
6 3300039093 Ga0400489_42137 Ga0400489_42137_29_628 164
7 3300044712 Ga0453684_1328933 Ga0453684_1328933_53_661 166
8 3300005467 Ga0070706_100287965 Ga0070706_1002879651 167
9 3300005536 Ga0070697_100779033 Ga0070697_1007790331 167
10 3300025922 Ga0207646_10158174 Ga0207646_101581742 167
11 3300031728 Ga0316578_10350092 Ga0316578_103500922 167
12 3300035398 Ga0316574_0339536 Ga0316574_0339536_180_779 167
13 3300037588 Ga0316581_0090151 Ga0316581_0090151_172_798 167
14 3300044712 Ga0453684_0477088 Ga0453684_0477088_597_1208 167
15 3300049588 Ga0501072_0282285 Ga0501072_0282285_118_744 167
16 3300049591 Ga0501075_0043505 Ga0501075_0043505_2092_2718 167
17 3300049592 Ga0501076_0040231 Ga0501076_0040231_1464_2090 167
18 3300049741 Ga0501079_0091341 Ga0501079_0091341_1280_1906 167
19 3300049742 Ga0501080_0045517 Ga0501080_0045517_776_1402 167
20 3300060353 Ga0501082_0378442 Ga0501082_0378442_492_1118 167
21 3300005546 Ga0070696_100201835 Ga0070696_1002018352 168
22 3300005549 Ga0070704_100272282 Ga0070704_1002722821 168
23 3300044712 Ga0453684_0110568 Ga0453684_0110568_193_810 168
24 3300045051 Ga0451576_0190431 Ga0451576_0190431_1268_1891 168
25 3300045051 Ga0451576_0222130 Ga0451576_0222130_409_1026 168
26 3300006194 Ga0075427_10001233 Ga0075427_100012332 169
27 3300006844 Ga0075428_100387874 Ga0075428_1003878742 169
28 3300006847 Ga0075431_100037168 Ga0075431_1000371684 169
29 3300006880 Ga0075429_100281134 Ga0075429_1002811342 169
30 3300031251 Ga0265327_10013384 Ga0265327_100133842 169
31 3300042876 Ga0451577_0010457 Ga0451577_0010457_482_1108 169
32 3300044712 Ga0453684_0000003 Ga0453684_0000003_1243695_1244321 169
33 3300044712 Ga0453684_0000430 Ga0453684_0000430_20831_21427 169
34 3300044712 Ga0453684_0017427 Ga0453684_0017427_4809_5426 169
35 3300044712 Ga0453684_0030986 Ga0453684_0030986_3140_3757 169
36 3300044712 Ga0453684_0215189 Ga0453684_0215189_475_1110 169
37 3300044712 Ga0453684_0384231 Ga0453684_0384231_691_1311 169
38 3300045051 Ga0451576_0040313 Ga0451576_0040313_1376_2011 169
39 3300050507 nmdc:mga05p37_108156_c1 nmdc:mga05p37_108156_c1_2193_2840 169
40 3300050509 nmdc:mga0qj67_163396_c1 nmdc:mga0qj67_163396_c1_721_1368 169
41 3300050510 nmdc:mga06r32_88379_c1 nmdc:mga06r32_88379_c1_1432_2079 169
42 3300050512 nmdc:mga0n895_211949_c1 nmdc:mga0n895_211949_c1_752_1390 169
43 3300003203 JGI25406J46586_10010267 JGI25406J46586_100102673 170
44 3300005577 Ga0068857_100203035 Ga0068857_1002030352 170
45 3300005985 Ga0081539_10006020 Ga0081539_1000602010 170
46 3300006880 Ga0075429_100321629 Ga0075429_1003216292 170
47 3300009147 Ga0114129_10156014 Ga0114129_101560142 170
48 3300009147 Ga0114129_10568405 Ga0114129_105684052 170
49 3300026116 Ga0207674_10303193 Ga0207674_103031932 170
50 3300028577 Ga0265318_10027832 Ga0265318_100278322 170
51 3300031247 Ga0265340_10064329 Ga0265340_100643292 170
52 3300031665 Ga0316575_10058071 Ga0316575_100580713 170
53 3300036647 Ga0316582_0097220 Ga0316582_0097220_942_1535 170
54 3300044673 Ga0453683_0004454 Ga0453683_0004454_5127_5756 170
55 3300044712 Ga0453684_0010082 Ga0453684_0010082_12786_13400 170
56 3300044712 Ga0453684_0075321 Ga0453684_0075321_1388_2002 170
57 3300044712 Ga0453684_0113416 Ga0453684_0113416_1513_2109 170
58 3300044712 Ga0453684_0790019 Ga0453684_0790019_76_708 170
59 3300045051 Ga0451576_0082935 Ga0451576_0082935_2669_3298 170
60 3300050507 nmdc:mga05p37_542245_c1 nmdc:mga05p37_542245_c1_574_1209 170
61 3300050508 nmdc:mga09592_130701_c1 nmdc:mga09592_130701_c1_809_1444 170
62 3300050510 nmdc:mga06r32_808220_c1 nmdc:mga06r32_808220_c1_152_805 170
63 3300005518 Ga0070699_100666120 Ga0070699_1006661201 171
64 3300005518 Ga0070699_100764789 Ga0070699_1007647892 171
65 3300005844 Ga0068862_100031716 Ga0068862_1000317165 171
66 3300009148 Ga0105243_10148490 Ga0105243_101484902 171
67 3300028653 Ga0265323_10045831 Ga0265323_100458311 171
68 3300031665 Ga0316575_10100266 Ga0316575_101002662 171
69 3300042876 Ga0451577_0169935 Ga0451577_0169935_1149_1772 171
70 3300044712 Ga0453684_0000044 Ga0453684_0000044_148795_149418 171
71 3300044712 Ga0453684_0000415 Ga0453684_0000415_157082_157696 171
72 3300044712 Ga0453684_0005462 Ga0453684_0005462_18751_19335 171
73 3300044712 Ga0453684_0942583 Ga0453684_0942583_236_856 171
74 3300049568 Ga0501031_0418153 Ga0501031_0418153_42_680 171
75 3300005340 Ga0070689_100258486 Ga0070689_1002584862 172
76 3300005471 Ga0070698_100710332 Ga0070698_1007103322 172
77 3300005518 Ga0070699_100657958 Ga0070699_1006579582 172
78 3300005536 Ga0070697_100157126 Ga0070697_1001571261 172
79 3300005549 Ga0070704_100441270 Ga0070704_1004412702 172
80 3300006847 Ga0075431_100152227 Ga0075431_1001522271 172
81 3300009147 Ga0114129_10032841 Ga0114129_100328412 172
82 3300009147 Ga0114129_10125125 Ga0114129_101251252 172
83 3300009553 Ga0105249_10568672 Ga0105249_105686722 172
84 3300025922 Ga0207646_10628452 Ga0207646_106284522 172
85 3300031731 Ga0307405_10089992 Ga0307405_100899922 172
86 3300031824 Ga0307413_10376528 Ga0307413_103765282 172
87 3300031852 Ga0307410_10178246 Ga0307410_101782462 172
88 3300032126 Ga0307415_100540750 Ga0307415_1005407502 172
89 3300042876 Ga0451577_0265702 Ga0451577_0265702_419_1054 172
90 3300042876 Ga0451577_0957097 Ga0451577_0957097_93_725 172
91 3300044673 Ga0453683_0024260 Ga0453683_0024260_1999_2631 172
92 3300044673 Ga0453683_0155538 Ga0453683_0155538_638_1261 172
93 3300044673 Ga0453683_0462987 Ga0453683_0462987_149_775 172
94 3300044712 Ga0453684_0164723 Ga0453684_0164723_795_1430 172
95 3300045051 Ga0451576_0004702 Ga0451576_0004702_9103_9735 172
96 3300045051 Ga0451576_0060492 Ga0451576_0060492_12_641 172
97 3300045051 Ga0451576_0107241 Ga0451576_0107241_1611_2243 172
98 3300050507 nmdc:mga05p37_364495_c1 nmdc:mga05p37_364495_c1_246_914 172
99 3300050507 nmdc:mga05p37_69163_c1 nmdc:mga05p37_69163_c1_432_1064 172
100 3300050508 nmdc:mga09592_144893_c1 nmdc:mga09592_144893_c1_247_915 172
101 3300050508 nmdc:mga09592_232275_c1 nmdc:mga09592_232275_c1_127_795 172
102 3300050515 nmdc:mga0a205_494867_c1 nmdc:mga0a205_494867_c1_41_673 172
103 3300005289 Ga0065704_10371875 Ga0065704_103718751 173
104 3300005295 Ga0065707_10083881 Ga0065707_100838813 173
105 3300005440 Ga0070705_100359433 Ga0070705_1003594331 173
106 3300005471 Ga0070698_100097389 Ga0070698_1000973892 173
107 3300005518 Ga0070699_100152682 Ga0070699_1001526822 173
108 3300005518 Ga0070699_100276798 Ga0070699_1002767982 173
109 3300005536 Ga0070697_100236338 Ga0070697_1002363382 173
110 3300005545 Ga0070695_100028268 Ga0070695_1000282682 173
111 3300005546 Ga0070696_100118621 Ga0070696_1001186212 173
112 3300005549 Ga0070704_100021038 Ga0070704_1000210382 173
113 3300006846 Ga0075430_100057689 Ga0075430_1000576893 173
114 3300006880 Ga0075429_100024929 Ga0075429_1000249293 173
115 3300006880 Ga0075429_100025143 Ga0075429_1000251432 173
116 3300009147 Ga0114129_10144754 Ga0114129_101447543 173
117 3300009148 Ga0105243_10099011 Ga0105243_100990113 173
118 3300009176 Ga0105242_10387929 Ga0105242_103879291 173
119 3300025935 Ga0207709_10081025 Ga0207709_100810252 173
120 3300025961 Ga0207712_10428929 Ga0207712_104289292 173
121 3300026118 Ga0207675_100175452 Ga0207675_1001754522 173
122 3300028380 Ga0268265_11260241 Ga0268265_112602411 173
123 3300032002 Ga0307416_100086377 Ga0307416_1000863772 173
124 3300042876 Ga0451577_0030948 Ga0451577_0030948_1988_2620 173
125 3300042876 Ga0451577_0327644 Ga0451577_0327644_331_954 173
126 3300042876 Ga0451577_0543136 Ga0451577_0543136_200_829 173
127 3300044712 Ga0453684_0044768 Ga0453684_0044768_3131_3763 173
128 3300044712 Ga0453684_0055145 Ga0453684_0055145_4029_4640 173
129 3300044712 Ga0453684_0119346 Ga0453684_0119346_2371_3000 173
130 3300044712 Ga0453684_0450751 Ga0453684_0450751_62_676 173
131 3300049587 Ga0501071_0290200 Ga0501071_0290200_132_764 173
132 3300050507 nmdc:mga05p37_108613_c1 nmdc:mga05p37_108613_c1_598_1233 173
133 3300050507 nmdc:mga05p37_241829_c1 nmdc:mga05p37_241829_c1_987_1619 173
134 3300050508 nmdc:mga09592_17976_c1 nmdc:mga09592_17976_c1_3622_4257 173
135 3300050509 nmdc:mga0qj67_82536_c1 nmdc:mga0qj67_82536_c1_889_1524 173
136 2162886007 SwRhRL2b_contig_3729193 SwRhRL2b_0999.00002940 174
137 3300005289 Ga0065704_10000566 Ga0065704_1000056614 174
138 3300005295 Ga0065707_10082660 Ga0065707_1008266011 174
139 3300005295 Ga0065707_10177891 Ga0065707_101778912 174
140 3300005440 Ga0070705_100106384 Ga0070705_1001063841 174
141 3300005441 Ga0070700_100038011 Ga0070700_1000380112 174
142 3300005444 Ga0070694_100058948 Ga0070694_1000589482 174
143 3300005468 Ga0070707_100888000 Ga0070707_1008880001 174
144 3300005545 Ga0070695_100180889 Ga0070695_1001808892 174
145 3300005549 Ga0070704_101031652 Ga0070704_1010316521 174
146 3300005577 Ga0068857_100049592 Ga0068857_1000495925 174
147 3300005617 Ga0068859_100041320 Ga0068859_1000413201 174
148 3300005617 Ga0068859_100190809 Ga0068859_1001908092 174
149 3300005840 Ga0068870_10109452 Ga0068870_101094522 174
150 3300005844 Ga0068862_100415322 Ga0068862_1004153222 174
151 3300006844 Ga0075428_100056888 Ga0075428_1000568884 174
152 3300006871 Ga0075434_100417924 Ga0075434_1004179242 174
153 3300006880 Ga0075429_100203932 Ga0075429_1002039322 174
154 3300006880 Ga0075429_100299647 Ga0075429_1002996472 174
155 3300006931 Ga0097620_100041320 Ga0097620_1000413206 174
156 3300006931 Ga0097620_100190800 Ga0097620_1001908002 174
157 3300009094 Ga0111539_10772140 Ga0111539_107721402 174
158 3300009147 Ga0114129_10009582 Ga0114129_100095823 174
159 3300009148 Ga0105243_10148087 Ga0105243_101480872 174
160 3300009174 Ga0105241_10767635 Ga0105241_107676351 174
161 3300009553 Ga0105249_10119333 Ga0105249_101193332 174
162 3300014326 Ga0157380_10108143 Ga0157380_101081432 174
163 3300025885 Ga0207653_10165299 Ga0207653_101652991 174
164 3300025908 Ga0207643_10101049 Ga0207643_101010492 174
165 3300025910 Ga0207684_10531500 Ga0207684_105315001 174
166 3300025935 Ga0207709_10061423 Ga0207709_100614233 174
167 3300026075 Ga0207708_10042200 Ga0207708_100422003 174
168 3300026095 Ga0207676_10324879 Ga0207676_103248792 174
169 3300026095 Ga0207676_11206097 Ga0207676_112060971 174
170 3300026116 Ga0207674_10305065 Ga0207674_103050652 174
171 3300031240 Ga0265320_10065200 Ga0265320_100652002 174
172 3300031824 Ga0307413_10139752 Ga0307413_101397522 174
173 3300031995 Ga0307409_100150425 Ga0307409_1001504252 174
174 3300032005 Ga0307411_10830482 Ga0307411_108304821 174
175 3300032126 Ga0307415_100040832 Ga0307415_1000408322 174
176 3300036712 Ga0316584_0031634 Ga0316584_0031634_2019_2639 174
177 3300042876 Ga0451577_0079777 Ga0451577_0079777_905_1546 174
178 3300044712 Ga0453684_0010741 Ga0453684_0010741_13843_14484 174
179 3300044712 Ga0453684_1076119 Ga0453684_1076119_148_780 174
180 3300045051 Ga0451576_0418287 Ga0451576_0418287_172_801 174
181 3300049741 Ga0501079_0111916 Ga0501079_0111916_1212_1850 174
182 3300050507 nmdc:mga05p37_6775_c1 nmdc:mga05p37_6775_c1_11593_12252 174
183 3300050508 nmdc:mga09592_149244_c1 nmdc:mga09592_149244_c1_582_1211 174
184 3300050508 nmdc:mga09592_18296_c2 nmdc:mga09592_18296_c2_2765_3424 174
185 3300050508 nmdc:mga09592_52551_c1 nmdc:mga09592_52551_c1_272_952 174
186 3300050511 nmdc:mga08y16_212089_c1 nmdc:mga08y16_212089_c1_1196_1834 174
187 3300050511 nmdc:mga08y16_712539_c1 nmdc:mga08y16_712539_c1_190_822 174
188 3300050512 nmdc:mga0n895_129472_c1 nmdc:mga0n895_129472_c1_417_1049 174
189 3300050515 nmdc:mga0a205_31346_c1 nmdc:mga0a205_31346_c1_4092_4724 174
190 3300054114 Ga0501084_0486806 Ga0501084_0486806_375_1013 174
191 3300060353 Ga0501082_0661741 Ga0501082_0661741_104_745 174

Feature Viewer

pLDDT pTM Quality
73.49 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map