F294183

General Info

Members Datasets Scaffolds Average Seq Length
191 137 191 335

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10010713|Ga0207674_100107136
Length 340
Sequence MGDWCLAPNYANIVSTGSYLPEIEVTNDMLRARFDAVAPEFVDKMEASSGILSRWYAPDDWATSDLAVRAARQALERAGKKPEDVDLIIVGTDSPDFITPATSVVVQDKLGAKNAGTFDVGCACASFPTALSSAAGMMAVSPNLKTVVVIGVYLMHKLASPDDPMIFFYGDGAGAAVLERSDEPGFVASAFRADGSYAKRWAIFGGGTVQPLAVPQVKMVERYPPEINNDGWPALVRQVAQNGGFAVSDIDFVVFTQVRKPTIELVMADLGLPMCKTHTIMERWGYTGSACIPMALDDALAKKKIKPGDLVVLVGSGVGYNQAAAAIRMPRHGAELFGER

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10246511 3300003322 Bacteria 3015
2 Ga0070658_10008618 3300005327 Bacteria 8199
3 Ga0070690_100193577 3300005330 Bacteria 1411
4 Ga0070690_100336867 3300005330 Bacteria 1091
5 Ga0070670_100000204 3300005331 Bacteria 55062
6 Ga0070682_100000015 3300005337 Bacteria 249390
7 Ga0068868_100001237 3300005338 Bacteria 17544
8 Ga0068868_100115582 3300005338 Bacteria 2184
9 Ga0070689_100005332 3300005340 Bacteria 8768
10 Ga0070692_10004315 3300005345 Bacteria 5915
11 Ga0070669_100000011 3300005353 Bacteria 216544
12 Ga0070675_100000007 3300005354 Bacteria 263394
13 Ga0070673_100179618 3300005364 Bacteria 1811
14 Ga0070673_100356901 3300005364 Bacteria 1299
15 Ga0070709_10249116 3300005434 Bacteria 1279
16 Ga0070713_100031508 3300005436 Bacteria 4224
17 Ga0070713_100104079 3300005436 Bacteria 2464
18 Ga0070700_100000024 3300005441 Bacteria 128154
19 Ga0070678_100025912 3300005456 Bacteria 3955
20 Ga0070685_10016036 3300005466 Bacteria 3985
21 Ga0070698_100235739 3300005471 Bacteria 1763
22 Ga0070684_100000094 3300005535 Bacteria 57284
23 Ga0068853_100012207 3300005539 Bacteria 6986
24 Ga0070672_100000251 3300005543 Bacteria 30261
25 Ga0070672_100264482 3300005543 Bacteria 1451
26 Ga0070686_100066135 3300005544 Bacteria 2350
27 Ga0070686_100144766 3300005544 Bacteria 1658
28 Ga0070693_100044932 3300005547 Bacteria 2501
29 Ga0070665_100000139 3300005548 Bacteria 135881
30 Ga0070665_100058978 3300005548 Bacteria 3847
31 Ga0068855_100310623 3300005563 Bacteria 1744
32 Ga0068857_100019715 3300005577 Bacteria 5924
33 Ga0068854_100006138 3300005578 Bacteria 7625
34 Ga0070702_100003740 3300005615 Bacteria 6863
35 Ga0068859_100000011 3300005617 Bacteria 309687
36 Ga0068864_100000009 3300005618 Bacteria 373756
37 Ga0068870_10143975 3300005840 Bacteria 1397
38 Ga0068858_100000638 3300005842 Bacteria 36454
39 Ga0068860_100001923 3300005843 Bacteria 21994
40 Ga0070717_10000086 3300006028 Bacteria 74612
41 Ga0070716_100025779 3300006173 Bacteria 3142
42 Ga0070716_100224159 3300006173 Bacteria 1265
43 Ga0097621_100250206 3300006237 Bacteria 1552
44 Ga0075431_100000720 3300006847 Bacteria 28520
45 Ga0075431_100163000 3300006847 Bacteria 2292
46 Ga0075434_100026559 3300006871 Bacteria 5674
47 Ga0075429_100244618 3300006880 Bacteria 1571
48 Ga0068865_100014458 3300006881 Bacteria 5015
49 Ga0075436_100001228 3300006914 Bacteria 17436
50 Ga0097620_100000011 3300006931 Bacteria 309687
51 Ga0075435_100000308 3300007076 Bacteria 30195
52 Ga0075435_100043874 3300007076 Bacteria 3581
53 Ga0105244_10003391 3300009036 Bacteria 11392
54 Ga0105240_10041208 3300009093 Bacteria 5896
55 Ga0111539_10000013 3300009094 Bacteria 309567
56 Ga0105245_10000058 3300009098 Bacteria 122870
57 Ga0105245_10003889 3300009098 Bacteria 13281
58 Ga0105242_10004828 3300009176 Bacteria 10435
59 Ga0105248_10214106 3300009177 Bacteria 2170
60 Ga0105238_10000001 3300009551 Bacteria 2036163
61 Ga0105239_10592120 3300010375 Bacteria 1265
62 Ga0157369_10000957 3300013105 Bacteria 36640
63 Ga0157369_10279590 3300013105 Unclassified 1738
64 Ga0157374_10000005 3300013296 Bacteria 646767
65 Ga0157374_10121229 3300013296 Bacteria 2524
66 Ga0157378_10001765 3300013297 Bacteria 19413
67 Ga0157378_10011832 3300013297 Bacteria 7638
68 Ga0157375_10000011 3300013308 Bacteria 334557
69 Ga0157375_10000060 3300013308 Bacteria 114761
70 Ga0157375_10000120 3300013308 Bacteria 76965
71 Ga0157375_10187899 3300013308 Bacteria 2220
72 Ga0163163_10491053 3300014325 Bacteria 1289
73 Ga0157377_10000001 3300014745 Bacteria 623098
74 Ga0157377_10000046 3300014745 Bacteria 96700
75 Ga0157377_10112919 3300014745 Bacteria 1636
76 Ga0157376_10000011 3300014969 Bacteria 307434
77 Ga0213873_10000004 3300021358 Bacteria 774374
78 Ga0213876_10000007 3300021384 Bacteria 670340
79 Ga0207655_1053997 3300025728 Bacteria 1601
80 Ga0207680_10034595 3300025903 Bacteria 2892
81 Ga0207699_10302444 3300025906 Bacteria 1117
82 Ga0207643_10147682 3300025908 Bacteria 1407
83 Ga0207705_10020874 3300025909 Bacteria 4675
84 Ga0207695_10029230 3300025913 Bacteria 6096
85 Ga0207681_10000012 3300025923 Bacteria 361565
86 Ga0207694_10000001 3300025924 Bacteria 4078485
87 Ga0207650_10000021 3300025925 Bacteria 322394
88 Ga0207659_10000016 3300025926 Bacteria 166927
89 Ga0207687_10000019 3300025927 Bacteria 234280
90 Ga0207687_10003087 3300025927 Bacteria 11295
91 Ga0207700_10057524 3300025928 Bacteria 2933
92 Ga0207670_10024545 3300025936 Bacteria 3769
93 Ga0207665_10025468 3300025939 Bacteria 3903
94 Ga0207691_10001396 3300025940 Bacteria 24170
95 Ga0207691_10260549 3300025940 Bacteria 1495
96 Ga0207711_10183714 3300025941 Bacteria 1902
97 Ga0207689_10001331 3300025942 Bacteria 23824
98 Ga0207689_10061155 3300025942 Bacteria 3097
99 Ga0207661_10000007 3300025944 Bacteria 471636
100 Ga0207667_10360800 3300025949 Bacteria 1482
101 Ga0207640_10002729 3300025981 Bacteria 9445
102 Ga0207677_10000010 3300026023 Bacteria 218007
103 Ga0207677_10000607 3300026023 Bacteria 22035
104 Ga0207703_10000151 3300026035 Bacteria 80005
105 Ga0207639_10000026 3300026041 Bacteria 205256
106 Ga0207708_10000146 3300026075 Bacteria 56397
107 Ga0207702_10116258 3300026078 Unclassified 2387
108 Ga0207702_10544520 3300026078 Bacteria 1135
109 Ga0207648_10110114 3300026089 Bacteria 2418
110 Ga0207676_10000007 3300026095 Bacteria 591074
111 Ga0207674_10010713 3300026116 Bacteria 10354
112 Ga0207675_100281843 3300026118 Bacteria 1615
113 Ga0207683_10019527 3300026121 Bacteria 5788
114 Ga0209970_1013813 3300027614 Bacteria 1340
115 Ga0209971_1000565 3300027682 Bacteria 9698
116 Ga0209974_10005963 3300027876 Bacteria 4269
117 Ga0207428_10000017 3300027907 Bacteria 309575
118 Ga0268266_10004453 3300028379 Bacteria 13399
119 Ga0268266_10020114 3300028379 Bacteria 5690
120 Ga0268264_10005978 3300028381 Bacteria 10304
121 Ga0307511_10002903 3300030521 Bacteria 17756
122 Ga0265327_10007004 3300031251 Bacteria 8840
123 Ga0265316_10113545 3300031344 Bacteria 2050
124 Ga0307508_10001983 3300031616 Bacteria 22369
125 Ga0316579_10009528 3300031691 Bacteria 4086
126 Ga0316579_10080698 3300031691 Unclassified 1548
127 Ga0316576_10000801 3300031727 Bacteria 15858
128 Ga0316576_10011471 3300031727 Bacteria 5809
129 Ga0316576_10013040 3300031727 Bacteria 5510
130 Ga0316576_10084729 3300031727 Bacteria 2356
131 Ga0316576_10096546 3300031727 Bacteria 2206
132 Ga0316576_10156314 3300031727 Bacteria 1719
133 Ga0316578_10067096 3300031728 Bacteria 2120
134 Ga0316577_10002082 3300031733 Bacteria 9780
135 Ga0316577_10020957 3300031733 Bacteria 3623
136 Ga0316577_10029622 3300031733 Bacteria 3055
137 Ga0316577_10034535 3300031733 Bacteria 2825
138 Ga0316577_10074769 3300031733 Bacteria 1892
139 Ga0316577_10191582 3300031733 Bacteria 1155
140 Ga0316583_10002751 3300032133 Bacteria 6152
141 Ga0373961_0002971 3300035241 Bacteria 4286
142 Ga0316574_0224944 3300035398 Bacteria 1202
143 Ga0373935_0061911 3300035692 Bacteria 2396
144 Ga0373933_0154418 3300035724 Bacteria 1455
145 Ga0316582_0010296 3300036647 Bacteria 5115
146 Ga0316582_0029676 3300036647 Unclassified 3324
147 Ga0316582_0112329 3300036647 Unclassified 1815
148 Ga0316584_0000075 3300036712 Bacteria 39683
149 Ga0316584_0000863 3300036712 Bacteria 17212
150 Ga0316584_0025511 3300036712 Bacteria 4336
151 Ga0316584_0045772 3300036712 Bacteria 3267
152 Ga0316584_0112712 3300036712 Unclassified 2035
153 Ga0316584_0117948 3300036712 Bacteria 1985
154 Ga0316584_0203410 3300036712 Bacteria 1460
155 Ga0395905_0074093 3300037471 Bacteria 3190
156 Ga0316581_0011617 3300037588 Bacteria 2466
157 Ga0316581_0018506 3300037588 Bacteria 2024
158 Ga0436365_0073603 3300039437 Bacteria 250590
159 Ga0436365_0653168 3300039437 Bacteria 7123
160 Ga0436365_1816191 3300039437 Bacteria 4294
161 Ga0436362_0290430 3300039453 Bacteria 772596
162 Ga0451577_0038658 3300042876 Bacteria 4291
163 Ga0451577_0087003 3300042876 Bacteria 2788
164 Ga0451577_0155594 3300042876 Bacteria 2057
165 Ga0453684_0020407 3300044712 Bacteria 9994
166 Ga0453684_0572424 3300044712 Bacteria 1241
167 Ga0451576_0012468 3300045051 Bacteria 9544
168 Ga0451576_0668927 3300045051 Bacteria 1091
169 Ga0495620_0007705 3300046515 Bacteria 5822
170 Ga0495628_0254073 3300046516 Bacteria 1311
171 Ga0495679_016884 3300047446 Bacteria 2628
172 Ga0501031_0280123 3300049568 Bacteria 1082
173 Ga0501067_0010486 3300049583 Bacteria 5130
174 Ga0501068_0004979 3300049584 Bacteria 7236
175 Ga0501073_0082432 3300049589 Bacteria 2237
176 Ga0501075_0009916 3300049591 Bacteria 6675
177 Ga0501077_0001050 3300049593 Bacteria 16665
178 Ga0501080_0020718 3300049742 Bacteria 6091
179 Ga0501083_0003280 3300049744 Bacteria 11303
180 Ga0501045_0215409 3300049824 Bacteria 1430
181 nmdc:mga09592_231416_c1 3300050508 Bacteria 1601
182 nmdc:mga06r32_121058_c1 3300050510 Bacteria 2582
183 nmdc:mga08y16_19_c1 3300050511 Bacteria 309575
184 nmdc:mga0n895_268203_c1 3300050512 Bacteria 1732
185 nmdc:mga0rr50_231532_c1 3300050513 Bacteria 1529
186 nmdc:mga0rr50_232_c1 3300050513 Bacteria 30195
187 nmdc:mga0rr50_59279_c1 3300050513 Bacteria 2873
188 nmdc:mga08x19_1023_c1 3300050514 Bacteria 9912
189 Ga0495655_0000819 3300053083 Bacteria 4885
190 Ga0495655_0048509 3300053083 Bacteria 1115
191 Ga0501082_0000026 3300060353 Bacteria 101000

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027614 Ga0209970_1013813 Ga0209970_10138132 293
2 3300027682 Ga0209971_1000565 Ga0209971_10005655 293
3 3300027876 Ga0209974_10005963 Ga0209974_100059632 293
4 3300005843 Ga0068860_100001923 Ga0068860_10000192311 318
5 3300028381 Ga0268264_10005978 Ga0268264_100059786 318
6 3300045051 Ga0451576_0668927 Ga0451576_0668927_111_1070 318
7 3300005456 Ga0070678_100025912 Ga0070678_1000259122 319
8 3300026121 Ga0207683_10019527 Ga0207683_100195273 319
9 3300025728 Ga0207655_1053997 Ga0207655_10539972 321
10 3300005577 Ga0068857_100019715 Ga0068857_1000197154 323
11 3300026116 Ga0207674_10010713 Ga0207674_100107136 323
12 3300053083 Ga0495655_0000819 Ga0495655_0000819_3077_4075 323
13 3300005563 Ga0068855_100310623 Ga0068855_1003106232 324
14 3300025949 Ga0207667_10360800 Ga0207667_103608002 324
15 3300005548 Ga0070665_100058978 Ga0070665_1000589783 326
16 3300028379 Ga0268266_10020114 Ga0268266_100201143 326
17 3300049583 Ga0501067_0010486 Ga0501067_0010486_1405_2385 326
18 3300049584 Ga0501068_0004979 Ga0501068_0004979_6213_7193 326
19 3300049591 Ga0501075_0009916 Ga0501075_0009916_2723_3703 326
20 3300049593 Ga0501077_0001050 Ga0501077_0001050_4486_5466 326
21 3300060353 Ga0501082_0000026 Ga0501082_0000026_52228_53208 326
22 3300005327 Ga0070658_10008618 Ga0070658_100086185 328
23 3300005330 Ga0070690_100193577 Ga0070690_1001935771 328
24 3300005337 Ga0070682_100000015 Ga0070682_100000015141 328
25 3300005338 Ga0068868_100001237 Ga0068868_1000012378 328
26 3300005340 Ga0070689_100005332 Ga0070689_1000053321 328
27 3300005345 Ga0070692_10004315 Ga0070692_100043155 328
28 3300005364 Ga0070673_100356901 Ga0070673_1003569012 328
29 3300005543 Ga0070672_100000251 Ga0070672_1000002513 328
30 3300005543 Ga0070672_100264482 Ga0070672_1002644822 328
31 3300005544 Ga0070686_100144766 Ga0070686_1001447662 328
32 3300005615 Ga0070702_100003740 Ga0070702_1000037402 328
33 3300005617 Ga0068859_100000011 Ga0068859_10000001192 328
34 3300005618 Ga0068864_100000009 Ga0068864_100000009246 328
35 3300005842 Ga0068858_100000638 Ga0068858_10000063831 328
36 3300006173 Ga0070716_100025779 Ga0070716_1000257793 328
37 3300006173 Ga0070716_100224159 Ga0070716_1002241592 328
38 3300006881 Ga0068865_100014458 Ga0068865_1000144583 328
39 3300006931 Ga0097620_100000011 Ga0097620_100000011161 328
40 3300007076 Ga0075435_100043874 Ga0075435_1000438743 328
41 3300009098 Ga0105245_10000058 Ga0105245_1000005872 328
42 3300009098 Ga0105245_10003889 Ga0105245_100038896 328
43 3300009177 Ga0105248_10214106 Ga0105248_102141062 328
44 3300010375 Ga0105239_10592120 Ga0105239_105921202 328
45 3300013297 Ga0157378_10001765 Ga0157378_100017659 328
46 3300013297 Ga0157378_10011832 Ga0157378_100118322 328
47 3300013308 Ga0157375_10000011 Ga0157375_10000011305 328
48 3300013308 Ga0157375_10000060 Ga0157375_1000006087 328
49 3300014325 Ga0163163_10491053 Ga0163163_104910532 328
50 3300025909 Ga0207705_10020874 Ga0207705_100208743 328
51 3300025927 Ga0207687_10000019 Ga0207687_1000001972 328
52 3300025927 Ga0207687_10003087 Ga0207687_100030874 328
53 3300025936 Ga0207670_10024545 Ga0207670_100245452 328
54 3300025939 Ga0207665_10025468 Ga0207665_100254683 328
55 3300025940 Ga0207691_10001396 Ga0207691_1000139624 328
56 3300025940 Ga0207691_10260549 Ga0207691_102605491 328
57 3300025941 Ga0207711_10183714 Ga0207711_101837142 328
58 3300025942 Ga0207689_10001331 Ga0207689_1000133118 328
59 3300026023 Ga0207677_10000010 Ga0207677_10000010120 328
60 3300026035 Ga0207703_10000151 Ga0207703_100001512 328
61 3300026089 Ga0207648_10110114 Ga0207648_101101143 328
62 3300026095 Ga0207676_10000007 Ga0207676_100000073 328
63 3300047446 Ga0495679_016884 Ga0495679_016884_335_1351 328
64 3300050513 nmdc:mga0rr50_59279_c1 nmdc:mga0rr50_59279_c1_403_1419 328
65 3300005353 Ga0070669_100000011 Ga0070669_100000011102 329
66 3300005354 Ga0070675_100000007 Ga0070675_10000000746 329
67 3300005364 Ga0070673_100179618 Ga0070673_1001796182 329
68 3300005434 Ga0070709_10249116 Ga0070709_102491161 329
69 3300005441 Ga0070700_100000024 Ga0070700_100000024107 329
70 3300005466 Ga0070685_10016036 Ga0070685_100160363 329
71 3300005471 Ga0070698_100235739 Ga0070698_1002357392 329
72 3300005539 Ga0068853_100012207 Ga0068853_1000122074 329
73 3300005544 Ga0070686_100066135 Ga0070686_1000661352 329
74 3300005548 Ga0070665_100000139 Ga0070665_100000139127 329
75 3300005840 Ga0068870_10143975 Ga0068870_101439752 329
76 3300006847 Ga0075431_100163000 Ga0075431_1001630001 329
77 3300006871 Ga0075434_100026559 Ga0075434_1000265596 329
78 3300006880 Ga0075429_100244618 Ga0075429_1002446182 329
79 3300009036 Ga0105244_10003391 Ga0105244_100033913 329
80 3300009093 Ga0105240_10041208 Ga0105240_100412083 329
81 3300009094 Ga0111539_10000013 Ga0111539_1000001387 329
82 3300009176 Ga0105242_10004828 Ga0105242_100048285 329
83 3300013105 Ga0157369_10279590 Ga0157369_102795902 329
84 3300013296 Ga0157374_10121229 Ga0157374_101212292 329
85 3300013308 Ga0157375_10187899 Ga0157375_101878993 329
86 3300014745 Ga0157377_10000046 Ga0157377_1000004633 329
87 3300014745 Ga0157377_10112919 Ga0157377_101129192 329
88 3300021358 Ga0213873_10000004 Ga0213873_10000004214 329
89 3300021384 Ga0213876_10000007 Ga0213876_10000007214 329
90 3300025906 Ga0207699_10302444 Ga0207699_103024442 329
91 3300025908 Ga0207643_10147682 Ga0207643_101476822 329
92 3300025913 Ga0207695_10029230 Ga0207695_100292303 329
93 3300025923 Ga0207681_10000012 Ga0207681_10000012185 329
94 3300025926 Ga0207659_10000016 Ga0207659_1000001690 329
95 3300025942 Ga0207689_10061155 Ga0207689_100611553 329
96 3300026041 Ga0207639_10000026 Ga0207639_10000026150 329
97 3300026075 Ga0207708_10000146 Ga0207708_1000014630 329
98 3300026118 Ga0207675_100281843 Ga0207675_1002818432 329
99 3300027907 Ga0207428_10000017 Ga0207428_10000017184 329
100 3300028379 Ga0268266_10004453 Ga0268266_1000445313 329
101 3300030521 Ga0307511_10002903 Ga0307511_100029038 329
102 3300031616 Ga0307508_10001983 Ga0307508_100019835 329
103 3300035241 Ga0373961_0002971 Ga0373961_0002971_3020_4021 329
104 3300035692 Ga0373935_0061911 Ga0373935_0061911_581_1570 329
105 3300039437 Ga0436365_0073603 Ga0436365_0073603_163794_164813 329
106 3300039453 Ga0436362_0290430 Ga0436362_0290430_517887_518906 329
107 3300042876 Ga0451577_0038658 Ga0451577_0038658_2828_3817 329
108 3300042876 Ga0451577_0087003 Ga0451577_0087003_538_1527 329
109 3300044712 Ga0453684_0020407 Ga0453684_0020407_3558_4547 329
110 3300046515 Ga0495620_0007705 Ga0495620_0007705_732_1751 329
111 3300049568 Ga0501031_0280123 Ga0501031_0280123_31_1026 329
112 3300049589 Ga0501073_0082432 Ga0501073_0082432_944_1963 329
113 3300049742 Ga0501080_0020718 Ga0501080_0020718_1865_2884 329
114 3300049744 Ga0501083_0003280 Ga0501083_0003280_3820_4809 329
115 3300049824 Ga0501045_0215409 Ga0501045_0215409_250_1245 329
116 3300050508 nmdc:mga09592_231416_c1 nmdc:mga09592_231416_c1_157_1176 329
117 3300050511 nmdc:mga08y16_19_c1 nmdc:mga08y16_19_c1_215158_216177 329
118 3300050512 nmdc:mga0n895_268203_c1 nmdc:mga0n895_268203_c1_715_1704 329
119 3300050513 nmdc:mga0rr50_231532_c1 nmdc:mga0rr50_231532_c1_24_1040 329
120 3300053083 Ga0495655_0048509 Ga0495655_0048509_38_1057 329
121 3300003322 rootL2_10246511 rootL2_102465114 330
122 3300005330 Ga0070690_100336867 Ga0070690_1003368671 330
123 3300005331 Ga0070670_100000204 Ga0070670_10000020428 330
124 3300005338 Ga0068868_100115582 Ga0068868_1001155822 330
125 3300005436 Ga0070713_100031508 Ga0070713_1000315083 330
126 3300005436 Ga0070713_100104079 Ga0070713_1001040792 330
127 3300005535 Ga0070684_100000094 Ga0070684_10000009410 330
128 3300005547 Ga0070693_100044932 Ga0070693_1000449322 330
129 3300005578 Ga0068854_100006138 Ga0068854_1000061385 330
130 3300006028 Ga0070717_10000086 Ga0070717_1000008622 330
131 3300006237 Ga0097621_100250206 Ga0097621_1002502062 330
132 3300006847 Ga0075431_100000720 Ga0075431_1000007205 330
133 3300006914 Ga0075436_100001228 Ga0075436_1000012289 330
134 3300007076 Ga0075435_100000308 Ga0075435_10000030820 330
135 3300009551 Ga0105238_10000001 Ga0105238_100000011449 330
136 3300013105 Ga0157369_10000957 Ga0157369_100009576 330
137 3300013296 Ga0157374_10000005 Ga0157374_10000005112 330
138 3300013308 Ga0157375_10000120 Ga0157375_1000012010 330
139 3300014745 Ga0157377_10000001 Ga0157377_10000001461 330
140 3300014969 Ga0157376_10000011 Ga0157376_1000001175 330
141 3300025903 Ga0207680_10034595 Ga0207680_100345952 330
142 3300025924 Ga0207694_10000001 Ga0207694_100000012485 330
143 3300025925 Ga0207650_10000021 Ga0207650_10000021265 330
144 3300025928 Ga0207700_10057524 Ga0207700_100575243 330
145 3300025944 Ga0207661_10000007 Ga0207661_10000007266 330
146 3300025981 Ga0207640_10002729 Ga0207640_100027296 330
147 3300026023 Ga0207677_10000607 Ga0207677_1000060722 330
148 3300026078 Ga0207702_10116258 Ga0207702_101162582 330
149 3300026078 Ga0207702_10544520 Ga0207702_105445201 330
150 3300031251 Ga0265327_10007004 Ga0265327_100070044 330
151 3300031344 Ga0265316_10113545 Ga0265316_101135452 330
152 3300031691 Ga0316579_10009528 Ga0316579_100095283 330
153 3300031691 Ga0316579_10080698 Ga0316579_100806982 330
154 3300031727 Ga0316576_10000801 Ga0316576_100008017 330
155 3300031727 Ga0316576_10011471 Ga0316576_100114712 330
156 3300031727 Ga0316576_10013040 Ga0316576_100130404 330
157 3300031727 Ga0316576_10084729 Ga0316576_100847291 330
158 3300031727 Ga0316576_10096546 Ga0316576_100965462 330
159 3300031727 Ga0316576_10156314 Ga0316576_101563141 330
160 3300031728 Ga0316578_10067096 Ga0316578_100670962 330
161 3300031733 Ga0316577_10002082 Ga0316577_100020829 330
162 3300031733 Ga0316577_10020957 Ga0316577_100209572 330
163 3300031733 Ga0316577_10029622 Ga0316577_100296223 330
164 3300031733 Ga0316577_10034535 Ga0316577_100345352 330
165 3300031733 Ga0316577_10074769 Ga0316577_100747691 330
166 3300031733 Ga0316577_10191582 Ga0316577_101915821 330
167 3300032133 Ga0316583_10002751 Ga0316583_100027513 330
168 3300035398 Ga0316574_0224944 Ga0316574_0224944_170_1162 330
169 3300035724 Ga0373933_0154418 Ga0373933_0154418_241_1233 330
170 3300036647 Ga0316582_0010296 Ga0316582_0010296_3183_4187 330
171 3300036647 Ga0316582_0029676 Ga0316582_0029676_190_1194 330
172 3300036647 Ga0316582_0112329 Ga0316582_0112329_295_1299 330
173 3300036712 Ga0316584_0000075 Ga0316584_0000075_4641_5642 330
174 3300036712 Ga0316584_0000863 Ga0316584_0000863_10793_11797 330
175 3300036712 Ga0316584_0025511 Ga0316584_0025511_3279_4271 330
176 3300036712 Ga0316584_0045772 Ga0316584_0045772_1693_2697 330
177 3300036712 Ga0316584_0112712 Ga0316584_0112712_1017_2021 330
178 3300036712 Ga0316584_0117948 Ga0316584_0117948_929_1921 330
179 3300036712 Ga0316584_0203410 Ga0316584_0203410_454_1446 330
180 3300037471 Ga0395905_0074093 Ga0395905_0074093_54_1055 330
181 3300037588 Ga0316581_0011617 Ga0316581_0011617_802_1806 330
182 3300037588 Ga0316581_0018506 Ga0316581_0018506_889_1893 330
183 3300039437 Ga0436365_0653168 Ga0436365_0653168_5604_6641 330
184 3300039437 Ga0436365_1816191 Ga0436365_1816191_858_1898 330
185 3300042876 Ga0451577_0155594 Ga0451577_0155594_498_1490 330
186 3300044712 Ga0453684_0572424 Ga0453684_0572424_236_1228 330
187 3300045051 Ga0451576_0012468 Ga0451576_0012468_1618_2610 330
188 3300046516 Ga0495628_0254073 Ga0495628_0254073_299_1291 330
189 3300050510 nmdc:mga06r32_121058_c1 nmdc:mga06r32_121058_c1_957_1985 330
190 3300050513 nmdc:mga0rr50_232_c1 nmdc:mga0rr50_232_c1_4164_5189 330
191 3300050514 nmdc:mga08x19_1023_c1 nmdc:mga08x19_1023_c1_3312_4352 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

240

329

0.97

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

118

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hnk-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form 0.9476 4 329
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9414 4 329
1hnk-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form 0.9408 4 329
8d1u-assembly1.cif.gz_A e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) with an acetylated cysteine and in complex with oxa(dethia)-coenzyme a 0.9394 3 329
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9373 4 329
ID Description Score Start End Superfamily
1hnkA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9728 232 329 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9288 4 329 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9256 4 330 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9231 4 329 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9178 3 329 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A1G3LA38-F1-model_v4 3-ketoacyl-ACP synthase 0.9772 1 329 GO:0004315
GO:0006633
GO:0044550
AF-A0A3D3FIE3-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein 0.9746 132 328 GO:0004315
GO:0006633
GO:0044550
AF-A0A1V5QVP9-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) synthase 3 (EC 2.3.1.180) 0.9742 236 329 GO:0033818
GO:0044550
AF-A0A7C8DUA1-F1-model_v4 Ketoacyl-ACP synthase III 0.9738 228 328 GO:0016746
AF-A0A353RQ49-F1-model_v4 Ketoacyl-ACP synthase III 0.9733 1 196 GO:0004315
GO:0006633
GO:0044550

Feature Viewer

pLDDT pTM Quality
94.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map