F294183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 191 | 137 | 191 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10010713|Ga0207674_100107136 |
| Length | 340 |
| Sequence | MGDWCLAPNYANIVSTGSYLPEIEVTNDMLRARFDAVAPEFVDKMEASSGILSRWYAPDDWATSDLAVRAARQALERAGKKPEDVDLIIVGTDSPDFITPATSVVVQDKLGAKNAGTFDVGCACASFPTALSSAAGMMAVSPNLKTVVVIGVYLMHKLASPDDPMIFFYGDGAGAAVLERSDEPGFVASAFRADGSYAKRWAIFGGGTVQPLAVPQVKMVERYPPEINNDGWPALVRQVAQNGGFAVSDIDFVVFTQVRKPTIELVMADLGLPMCKTHTIMERWGYTGSACIPMALDDALAKKKIKPGDLVVLVGSGVGYNQAAAAIRMPRHGAELFGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 97 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 100 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 101 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 102 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 103 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 104 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 105 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 110 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10246511 | 3300003322 | Bacteria | 3015 |
| 2 | Ga0070658_10008618 | 3300005327 | Bacteria | 8199 |
| 3 | Ga0070690_100193577 | 3300005330 | Bacteria | 1411 |
| 4 | Ga0070690_100336867 | 3300005330 | Bacteria | 1091 |
| 5 | Ga0070670_100000204 | 3300005331 | Bacteria | 55062 |
| 6 | Ga0070682_100000015 | 3300005337 | Bacteria | 249390 |
| 7 | Ga0068868_100001237 | 3300005338 | Bacteria | 17544 |
| 8 | Ga0068868_100115582 | 3300005338 | Bacteria | 2184 |
| 9 | Ga0070689_100005332 | 3300005340 | Bacteria | 8768 |
| 10 | Ga0070692_10004315 | 3300005345 | Bacteria | 5915 |
| 11 | Ga0070669_100000011 | 3300005353 | Bacteria | 216544 |
| 12 | Ga0070675_100000007 | 3300005354 | Bacteria | 263394 |
| 13 | Ga0070673_100179618 | 3300005364 | Bacteria | 1811 |
| 14 | Ga0070673_100356901 | 3300005364 | Bacteria | 1299 |
| 15 | Ga0070709_10249116 | 3300005434 | Bacteria | 1279 |
| 16 | Ga0070713_100031508 | 3300005436 | Bacteria | 4224 |
| 17 | Ga0070713_100104079 | 3300005436 | Bacteria | 2464 |
| 18 | Ga0070700_100000024 | 3300005441 | Bacteria | 128154 |
| 19 | Ga0070678_100025912 | 3300005456 | Bacteria | 3955 |
| 20 | Ga0070685_10016036 | 3300005466 | Bacteria | 3985 |
| 21 | Ga0070698_100235739 | 3300005471 | Bacteria | 1763 |
| 22 | Ga0070684_100000094 | 3300005535 | Bacteria | 57284 |
| 23 | Ga0068853_100012207 | 3300005539 | Bacteria | 6986 |
| 24 | Ga0070672_100000251 | 3300005543 | Bacteria | 30261 |
| 25 | Ga0070672_100264482 | 3300005543 | Bacteria | 1451 |
| 26 | Ga0070686_100066135 | 3300005544 | Bacteria | 2350 |
| 27 | Ga0070686_100144766 | 3300005544 | Bacteria | 1658 |
| 28 | Ga0070693_100044932 | 3300005547 | Bacteria | 2501 |
| 29 | Ga0070665_100000139 | 3300005548 | Bacteria | 135881 |
| 30 | Ga0070665_100058978 | 3300005548 | Bacteria | 3847 |
| 31 | Ga0068855_100310623 | 3300005563 | Bacteria | 1744 |
| 32 | Ga0068857_100019715 | 3300005577 | Bacteria | 5924 |
| 33 | Ga0068854_100006138 | 3300005578 | Bacteria | 7625 |
| 34 | Ga0070702_100003740 | 3300005615 | Bacteria | 6863 |
| 35 | Ga0068859_100000011 | 3300005617 | Bacteria | 309687 |
| 36 | Ga0068864_100000009 | 3300005618 | Bacteria | 373756 |
| 37 | Ga0068870_10143975 | 3300005840 | Bacteria | 1397 |
| 38 | Ga0068858_100000638 | 3300005842 | Bacteria | 36454 |
| 39 | Ga0068860_100001923 | 3300005843 | Bacteria | 21994 |
| 40 | Ga0070717_10000086 | 3300006028 | Bacteria | 74612 |
| 41 | Ga0070716_100025779 | 3300006173 | Bacteria | 3142 |
| 42 | Ga0070716_100224159 | 3300006173 | Bacteria | 1265 |
| 43 | Ga0097621_100250206 | 3300006237 | Bacteria | 1552 |
| 44 | Ga0075431_100000720 | 3300006847 | Bacteria | 28520 |
| 45 | Ga0075431_100163000 | 3300006847 | Bacteria | 2292 |
| 46 | Ga0075434_100026559 | 3300006871 | Bacteria | 5674 |
| 47 | Ga0075429_100244618 | 3300006880 | Bacteria | 1571 |
| 48 | Ga0068865_100014458 | 3300006881 | Bacteria | 5015 |
| 49 | Ga0075436_100001228 | 3300006914 | Bacteria | 17436 |
| 50 | Ga0097620_100000011 | 3300006931 | Bacteria | 309687 |
| 51 | Ga0075435_100000308 | 3300007076 | Bacteria | 30195 |
| 52 | Ga0075435_100043874 | 3300007076 | Bacteria | 3581 |
| 53 | Ga0105244_10003391 | 3300009036 | Bacteria | 11392 |
| 54 | Ga0105240_10041208 | 3300009093 | Bacteria | 5896 |
| 55 | Ga0111539_10000013 | 3300009094 | Bacteria | 309567 |
| 56 | Ga0105245_10000058 | 3300009098 | Bacteria | 122870 |
| 57 | Ga0105245_10003889 | 3300009098 | Bacteria | 13281 |
| 58 | Ga0105242_10004828 | 3300009176 | Bacteria | 10435 |
| 59 | Ga0105248_10214106 | 3300009177 | Bacteria | 2170 |
| 60 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 61 | Ga0105239_10592120 | 3300010375 | Bacteria | 1265 |
| 62 | Ga0157369_10000957 | 3300013105 | Bacteria | 36640 |
| 63 | Ga0157369_10279590 | 3300013105 | Unclassified | 1738 |
| 64 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 65 | Ga0157374_10121229 | 3300013296 | Bacteria | 2524 |
| 66 | Ga0157378_10001765 | 3300013297 | Bacteria | 19413 |
| 67 | Ga0157378_10011832 | 3300013297 | Bacteria | 7638 |
| 68 | Ga0157375_10000011 | 3300013308 | Bacteria | 334557 |
| 69 | Ga0157375_10000060 | 3300013308 | Bacteria | 114761 |
| 70 | Ga0157375_10000120 | 3300013308 | Bacteria | 76965 |
| 71 | Ga0157375_10187899 | 3300013308 | Bacteria | 2220 |
| 72 | Ga0163163_10491053 | 3300014325 | Bacteria | 1289 |
| 73 | Ga0157377_10000001 | 3300014745 | Bacteria | 623098 |
| 74 | Ga0157377_10000046 | 3300014745 | Bacteria | 96700 |
| 75 | Ga0157377_10112919 | 3300014745 | Bacteria | 1636 |
| 76 | Ga0157376_10000011 | 3300014969 | Bacteria | 307434 |
| 77 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 78 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 79 | Ga0207655_1053997 | 3300025728 | Bacteria | 1601 |
| 80 | Ga0207680_10034595 | 3300025903 | Bacteria | 2892 |
| 81 | Ga0207699_10302444 | 3300025906 | Bacteria | 1117 |
| 82 | Ga0207643_10147682 | 3300025908 | Bacteria | 1407 |
| 83 | Ga0207705_10020874 | 3300025909 | Bacteria | 4675 |
| 84 | Ga0207695_10029230 | 3300025913 | Bacteria | 6096 |
| 85 | Ga0207681_10000012 | 3300025923 | Bacteria | 361565 |
| 86 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 87 | Ga0207650_10000021 | 3300025925 | Bacteria | 322394 |
| 88 | Ga0207659_10000016 | 3300025926 | Bacteria | 166927 |
| 89 | Ga0207687_10000019 | 3300025927 | Bacteria | 234280 |
| 90 | Ga0207687_10003087 | 3300025927 | Bacteria | 11295 |
| 91 | Ga0207700_10057524 | 3300025928 | Bacteria | 2933 |
| 92 | Ga0207670_10024545 | 3300025936 | Bacteria | 3769 |
| 93 | Ga0207665_10025468 | 3300025939 | Bacteria | 3903 |
| 94 | Ga0207691_10001396 | 3300025940 | Bacteria | 24170 |
| 95 | Ga0207691_10260549 | 3300025940 | Bacteria | 1495 |
| 96 | Ga0207711_10183714 | 3300025941 | Bacteria | 1902 |
| 97 | Ga0207689_10001331 | 3300025942 | Bacteria | 23824 |
| 98 | Ga0207689_10061155 | 3300025942 | Bacteria | 3097 |
| 99 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 100 | Ga0207667_10360800 | 3300025949 | Bacteria | 1482 |
| 101 | Ga0207640_10002729 | 3300025981 | Bacteria | 9445 |
| 102 | Ga0207677_10000010 | 3300026023 | Bacteria | 218007 |
| 103 | Ga0207677_10000607 | 3300026023 | Bacteria | 22035 |
| 104 | Ga0207703_10000151 | 3300026035 | Bacteria | 80005 |
| 105 | Ga0207639_10000026 | 3300026041 | Bacteria | 205256 |
| 106 | Ga0207708_10000146 | 3300026075 | Bacteria | 56397 |
| 107 | Ga0207702_10116258 | 3300026078 | Unclassified | 2387 |
| 108 | Ga0207702_10544520 | 3300026078 | Bacteria | 1135 |
| 109 | Ga0207648_10110114 | 3300026089 | Bacteria | 2418 |
| 110 | Ga0207676_10000007 | 3300026095 | Bacteria | 591074 |
| 111 | Ga0207674_10010713 | 3300026116 | Bacteria | 10354 |
| 112 | Ga0207675_100281843 | 3300026118 | Bacteria | 1615 |
| 113 | Ga0207683_10019527 | 3300026121 | Bacteria | 5788 |
| 114 | Ga0209970_1013813 | 3300027614 | Bacteria | 1340 |
| 115 | Ga0209971_1000565 | 3300027682 | Bacteria | 9698 |
| 116 | Ga0209974_10005963 | 3300027876 | Bacteria | 4269 |
| 117 | Ga0207428_10000017 | 3300027907 | Bacteria | 309575 |
| 118 | Ga0268266_10004453 | 3300028379 | Bacteria | 13399 |
| 119 | Ga0268266_10020114 | 3300028379 | Bacteria | 5690 |
| 120 | Ga0268264_10005978 | 3300028381 | Bacteria | 10304 |
| 121 | Ga0307511_10002903 | 3300030521 | Bacteria | 17756 |
| 122 | Ga0265327_10007004 | 3300031251 | Bacteria | 8840 |
| 123 | Ga0265316_10113545 | 3300031344 | Bacteria | 2050 |
| 124 | Ga0307508_10001983 | 3300031616 | Bacteria | 22369 |
| 125 | Ga0316579_10009528 | 3300031691 | Bacteria | 4086 |
| 126 | Ga0316579_10080698 | 3300031691 | Unclassified | 1548 |
| 127 | Ga0316576_10000801 | 3300031727 | Bacteria | 15858 |
| 128 | Ga0316576_10011471 | 3300031727 | Bacteria | 5809 |
| 129 | Ga0316576_10013040 | 3300031727 | Bacteria | 5510 |
| 130 | Ga0316576_10084729 | 3300031727 | Bacteria | 2356 |
| 131 | Ga0316576_10096546 | 3300031727 | Bacteria | 2206 |
| 132 | Ga0316576_10156314 | 3300031727 | Bacteria | 1719 |
| 133 | Ga0316578_10067096 | 3300031728 | Bacteria | 2120 |
| 134 | Ga0316577_10002082 | 3300031733 | Bacteria | 9780 |
| 135 | Ga0316577_10020957 | 3300031733 | Bacteria | 3623 |
| 136 | Ga0316577_10029622 | 3300031733 | Bacteria | 3055 |
| 137 | Ga0316577_10034535 | 3300031733 | Bacteria | 2825 |
| 138 | Ga0316577_10074769 | 3300031733 | Bacteria | 1892 |
| 139 | Ga0316577_10191582 | 3300031733 | Bacteria | 1155 |
| 140 | Ga0316583_10002751 | 3300032133 | Bacteria | 6152 |
| 141 | Ga0373961_0002971 | 3300035241 | Bacteria | 4286 |
| 142 | Ga0316574_0224944 | 3300035398 | Bacteria | 1202 |
| 143 | Ga0373935_0061911 | 3300035692 | Bacteria | 2396 |
| 144 | Ga0373933_0154418 | 3300035724 | Bacteria | 1455 |
| 145 | Ga0316582_0010296 | 3300036647 | Bacteria | 5115 |
| 146 | Ga0316582_0029676 | 3300036647 | Unclassified | 3324 |
| 147 | Ga0316582_0112329 | 3300036647 | Unclassified | 1815 |
| 148 | Ga0316584_0000075 | 3300036712 | Bacteria | 39683 |
| 149 | Ga0316584_0000863 | 3300036712 | Bacteria | 17212 |
| 150 | Ga0316584_0025511 | 3300036712 | Bacteria | 4336 |
| 151 | Ga0316584_0045772 | 3300036712 | Bacteria | 3267 |
| 152 | Ga0316584_0112712 | 3300036712 | Unclassified | 2035 |
| 153 | Ga0316584_0117948 | 3300036712 | Bacteria | 1985 |
| 154 | Ga0316584_0203410 | 3300036712 | Bacteria | 1460 |
| 155 | Ga0395905_0074093 | 3300037471 | Bacteria | 3190 |
| 156 | Ga0316581_0011617 | 3300037588 | Bacteria | 2466 |
| 157 | Ga0316581_0018506 | 3300037588 | Bacteria | 2024 |
| 158 | Ga0436365_0073603 | 3300039437 | Bacteria | 250590 |
| 159 | Ga0436365_0653168 | 3300039437 | Bacteria | 7123 |
| 160 | Ga0436365_1816191 | 3300039437 | Bacteria | 4294 |
| 161 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 162 | Ga0451577_0038658 | 3300042876 | Bacteria | 4291 |
| 163 | Ga0451577_0087003 | 3300042876 | Bacteria | 2788 |
| 164 | Ga0451577_0155594 | 3300042876 | Bacteria | 2057 |
| 165 | Ga0453684_0020407 | 3300044712 | Bacteria | 9994 |
| 166 | Ga0453684_0572424 | 3300044712 | Bacteria | 1241 |
| 167 | Ga0451576_0012468 | 3300045051 | Bacteria | 9544 |
| 168 | Ga0451576_0668927 | 3300045051 | Bacteria | 1091 |
| 169 | Ga0495620_0007705 | 3300046515 | Bacteria | 5822 |
| 170 | Ga0495628_0254073 | 3300046516 | Bacteria | 1311 |
| 171 | Ga0495679_016884 | 3300047446 | Bacteria | 2628 |
| 172 | Ga0501031_0280123 | 3300049568 | Bacteria | 1082 |
| 173 | Ga0501067_0010486 | 3300049583 | Bacteria | 5130 |
| 174 | Ga0501068_0004979 | 3300049584 | Bacteria | 7236 |
| 175 | Ga0501073_0082432 | 3300049589 | Bacteria | 2237 |
| 176 | Ga0501075_0009916 | 3300049591 | Bacteria | 6675 |
| 177 | Ga0501077_0001050 | 3300049593 | Bacteria | 16665 |
| 178 | Ga0501080_0020718 | 3300049742 | Bacteria | 6091 |
| 179 | Ga0501083_0003280 | 3300049744 | Bacteria | 11303 |
| 180 | Ga0501045_0215409 | 3300049824 | Bacteria | 1430 |
| 181 | nmdc:mga09592_231416_c1 | 3300050508 | Bacteria | 1601 |
| 182 | nmdc:mga06r32_121058_c1 | 3300050510 | Bacteria | 2582 |
| 183 | nmdc:mga08y16_19_c1 | 3300050511 | Bacteria | 309575 |
| 184 | nmdc:mga0n895_268203_c1 | 3300050512 | Bacteria | 1732 |
| 185 | nmdc:mga0rr50_231532_c1 | 3300050513 | Bacteria | 1529 |
| 186 | nmdc:mga0rr50_232_c1 | 3300050513 | Bacteria | 30195 |
| 187 | nmdc:mga0rr50_59279_c1 | 3300050513 | Bacteria | 2873 |
| 188 | nmdc:mga08x19_1023_c1 | 3300050514 | Bacteria | 9912 |
| 189 | Ga0495655_0000819 | 3300053083 | Bacteria | 4885 |
| 190 | Ga0495655_0048509 | 3300053083 | Bacteria | 1115 |
| 191 | Ga0501082_0000026 | 3300060353 | Bacteria | 101000 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027614 | Ga0209970_1013813 | Ga0209970_10138132 | 293 |
| 2 | 3300027682 | Ga0209971_1000565 | Ga0209971_10005655 | 293 |
| 3 | 3300027876 | Ga0209974_10005963 | Ga0209974_100059632 | 293 |
| 4 | 3300005843 | Ga0068860_100001923 | Ga0068860_10000192311 | 318 |
| 5 | 3300028381 | Ga0268264_10005978 | Ga0268264_100059786 | 318 |
| 6 | 3300045051 | Ga0451576_0668927 | Ga0451576_0668927_111_1070 | 318 |
| 7 | 3300005456 | Ga0070678_100025912 | Ga0070678_1000259122 | 319 |
| 8 | 3300026121 | Ga0207683_10019527 | Ga0207683_100195273 | 319 |
| 9 | 3300025728 | Ga0207655_1053997 | Ga0207655_10539972 | 321 |
| 10 | 3300005577 | Ga0068857_100019715 | Ga0068857_1000197154 | 323 |
| 11 | 3300026116 | Ga0207674_10010713 | Ga0207674_100107136 | 323 |
| 12 | 3300053083 | Ga0495655_0000819 | Ga0495655_0000819_3077_4075 | 323 |
| 13 | 3300005563 | Ga0068855_100310623 | Ga0068855_1003106232 | 324 |
| 14 | 3300025949 | Ga0207667_10360800 | Ga0207667_103608002 | 324 |
| 15 | 3300005548 | Ga0070665_100058978 | Ga0070665_1000589783 | 326 |
| 16 | 3300028379 | Ga0268266_10020114 | Ga0268266_100201143 | 326 |
| 17 | 3300049583 | Ga0501067_0010486 | Ga0501067_0010486_1405_2385 | 326 |
| 18 | 3300049584 | Ga0501068_0004979 | Ga0501068_0004979_6213_7193 | 326 |
| 19 | 3300049591 | Ga0501075_0009916 | Ga0501075_0009916_2723_3703 | 326 |
| 20 | 3300049593 | Ga0501077_0001050 | Ga0501077_0001050_4486_5466 | 326 |
| 21 | 3300060353 | Ga0501082_0000026 | Ga0501082_0000026_52228_53208 | 326 |
| 22 | 3300005327 | Ga0070658_10008618 | Ga0070658_100086185 | 328 |
| 23 | 3300005330 | Ga0070690_100193577 | Ga0070690_1001935771 | 328 |
| 24 | 3300005337 | Ga0070682_100000015 | Ga0070682_100000015141 | 328 |
| 25 | 3300005338 | Ga0068868_100001237 | Ga0068868_1000012378 | 328 |
| 26 | 3300005340 | Ga0070689_100005332 | Ga0070689_1000053321 | 328 |
| 27 | 3300005345 | Ga0070692_10004315 | Ga0070692_100043155 | 328 |
| 28 | 3300005364 | Ga0070673_100356901 | Ga0070673_1003569012 | 328 |
| 29 | 3300005543 | Ga0070672_100000251 | Ga0070672_1000002513 | 328 |
| 30 | 3300005543 | Ga0070672_100264482 | Ga0070672_1002644822 | 328 |
| 31 | 3300005544 | Ga0070686_100144766 | Ga0070686_1001447662 | 328 |
| 32 | 3300005615 | Ga0070702_100003740 | Ga0070702_1000037402 | 328 |
| 33 | 3300005617 | Ga0068859_100000011 | Ga0068859_10000001192 | 328 |
| 34 | 3300005618 | Ga0068864_100000009 | Ga0068864_100000009246 | 328 |
| 35 | 3300005842 | Ga0068858_100000638 | Ga0068858_10000063831 | 328 |
| 36 | 3300006173 | Ga0070716_100025779 | Ga0070716_1000257793 | 328 |
| 37 | 3300006173 | Ga0070716_100224159 | Ga0070716_1002241592 | 328 |
| 38 | 3300006881 | Ga0068865_100014458 | Ga0068865_1000144583 | 328 |
| 39 | 3300006931 | Ga0097620_100000011 | Ga0097620_100000011161 | 328 |
| 40 | 3300007076 | Ga0075435_100043874 | Ga0075435_1000438743 | 328 |
| 41 | 3300009098 | Ga0105245_10000058 | Ga0105245_1000005872 | 328 |
| 42 | 3300009098 | Ga0105245_10003889 | Ga0105245_100038896 | 328 |
| 43 | 3300009177 | Ga0105248_10214106 | Ga0105248_102141062 | 328 |
| 44 | 3300010375 | Ga0105239_10592120 | Ga0105239_105921202 | 328 |
| 45 | 3300013297 | Ga0157378_10001765 | Ga0157378_100017659 | 328 |
| 46 | 3300013297 | Ga0157378_10011832 | Ga0157378_100118322 | 328 |
| 47 | 3300013308 | Ga0157375_10000011 | Ga0157375_10000011305 | 328 |
| 48 | 3300013308 | Ga0157375_10000060 | Ga0157375_1000006087 | 328 |
| 49 | 3300014325 | Ga0163163_10491053 | Ga0163163_104910532 | 328 |
| 50 | 3300025909 | Ga0207705_10020874 | Ga0207705_100208743 | 328 |
| 51 | 3300025927 | Ga0207687_10000019 | Ga0207687_1000001972 | 328 |
| 52 | 3300025927 | Ga0207687_10003087 | Ga0207687_100030874 | 328 |
| 53 | 3300025936 | Ga0207670_10024545 | Ga0207670_100245452 | 328 |
| 54 | 3300025939 | Ga0207665_10025468 | Ga0207665_100254683 | 328 |
| 55 | 3300025940 | Ga0207691_10001396 | Ga0207691_1000139624 | 328 |
| 56 | 3300025940 | Ga0207691_10260549 | Ga0207691_102605491 | 328 |
| 57 | 3300025941 | Ga0207711_10183714 | Ga0207711_101837142 | 328 |
| 58 | 3300025942 | Ga0207689_10001331 | Ga0207689_1000133118 | 328 |
| 59 | 3300026023 | Ga0207677_10000010 | Ga0207677_10000010120 | 328 |
| 60 | 3300026035 | Ga0207703_10000151 | Ga0207703_100001512 | 328 |
| 61 | 3300026089 | Ga0207648_10110114 | Ga0207648_101101143 | 328 |
| 62 | 3300026095 | Ga0207676_10000007 | Ga0207676_100000073 | 328 |
| 63 | 3300047446 | Ga0495679_016884 | Ga0495679_016884_335_1351 | 328 |
| 64 | 3300050513 | nmdc:mga0rr50_59279_c1 | nmdc:mga0rr50_59279_c1_403_1419 | 328 |
| 65 | 3300005353 | Ga0070669_100000011 | Ga0070669_100000011102 | 329 |
| 66 | 3300005354 | Ga0070675_100000007 | Ga0070675_10000000746 | 329 |
| 67 | 3300005364 | Ga0070673_100179618 | Ga0070673_1001796182 | 329 |
| 68 | 3300005434 | Ga0070709_10249116 | Ga0070709_102491161 | 329 |
| 69 | 3300005441 | Ga0070700_100000024 | Ga0070700_100000024107 | 329 |
| 70 | 3300005466 | Ga0070685_10016036 | Ga0070685_100160363 | 329 |
| 71 | 3300005471 | Ga0070698_100235739 | Ga0070698_1002357392 | 329 |
| 72 | 3300005539 | Ga0068853_100012207 | Ga0068853_1000122074 | 329 |
| 73 | 3300005544 | Ga0070686_100066135 | Ga0070686_1000661352 | 329 |
| 74 | 3300005548 | Ga0070665_100000139 | Ga0070665_100000139127 | 329 |
| 75 | 3300005840 | Ga0068870_10143975 | Ga0068870_101439752 | 329 |
| 76 | 3300006847 | Ga0075431_100163000 | Ga0075431_1001630001 | 329 |
| 77 | 3300006871 | Ga0075434_100026559 | Ga0075434_1000265596 | 329 |
| 78 | 3300006880 | Ga0075429_100244618 | Ga0075429_1002446182 | 329 |
| 79 | 3300009036 | Ga0105244_10003391 | Ga0105244_100033913 | 329 |
| 80 | 3300009093 | Ga0105240_10041208 | Ga0105240_100412083 | 329 |
| 81 | 3300009094 | Ga0111539_10000013 | Ga0111539_1000001387 | 329 |
| 82 | 3300009176 | Ga0105242_10004828 | Ga0105242_100048285 | 329 |
| 83 | 3300013105 | Ga0157369_10279590 | Ga0157369_102795902 | 329 |
| 84 | 3300013296 | Ga0157374_10121229 | Ga0157374_101212292 | 329 |
| 85 | 3300013308 | Ga0157375_10187899 | Ga0157375_101878993 | 329 |
| 86 | 3300014745 | Ga0157377_10000046 | Ga0157377_1000004633 | 329 |
| 87 | 3300014745 | Ga0157377_10112919 | Ga0157377_101129192 | 329 |
| 88 | 3300021358 | Ga0213873_10000004 | Ga0213873_10000004214 | 329 |
| 89 | 3300021384 | Ga0213876_10000007 | Ga0213876_10000007214 | 329 |
| 90 | 3300025906 | Ga0207699_10302444 | Ga0207699_103024442 | 329 |
| 91 | 3300025908 | Ga0207643_10147682 | Ga0207643_101476822 | 329 |
| 92 | 3300025913 | Ga0207695_10029230 | Ga0207695_100292303 | 329 |
| 93 | 3300025923 | Ga0207681_10000012 | Ga0207681_10000012185 | 329 |
| 94 | 3300025926 | Ga0207659_10000016 | Ga0207659_1000001690 | 329 |
| 95 | 3300025942 | Ga0207689_10061155 | Ga0207689_100611553 | 329 |
| 96 | 3300026041 | Ga0207639_10000026 | Ga0207639_10000026150 | 329 |
| 97 | 3300026075 | Ga0207708_10000146 | Ga0207708_1000014630 | 329 |
| 98 | 3300026118 | Ga0207675_100281843 | Ga0207675_1002818432 | 329 |
| 99 | 3300027907 | Ga0207428_10000017 | Ga0207428_10000017184 | 329 |
| 100 | 3300028379 | Ga0268266_10004453 | Ga0268266_1000445313 | 329 |
| 101 | 3300030521 | Ga0307511_10002903 | Ga0307511_100029038 | 329 |
| 102 | 3300031616 | Ga0307508_10001983 | Ga0307508_100019835 | 329 |
| 103 | 3300035241 | Ga0373961_0002971 | Ga0373961_0002971_3020_4021 | 329 |
| 104 | 3300035692 | Ga0373935_0061911 | Ga0373935_0061911_581_1570 | 329 |
| 105 | 3300039437 | Ga0436365_0073603 | Ga0436365_0073603_163794_164813 | 329 |
| 106 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_517887_518906 | 329 |
| 107 | 3300042876 | Ga0451577_0038658 | Ga0451577_0038658_2828_3817 | 329 |
| 108 | 3300042876 | Ga0451577_0087003 | Ga0451577_0087003_538_1527 | 329 |
| 109 | 3300044712 | Ga0453684_0020407 | Ga0453684_0020407_3558_4547 | 329 |
| 110 | 3300046515 | Ga0495620_0007705 | Ga0495620_0007705_732_1751 | 329 |
| 111 | 3300049568 | Ga0501031_0280123 | Ga0501031_0280123_31_1026 | 329 |
| 112 | 3300049589 | Ga0501073_0082432 | Ga0501073_0082432_944_1963 | 329 |
| 113 | 3300049742 | Ga0501080_0020718 | Ga0501080_0020718_1865_2884 | 329 |
| 114 | 3300049744 | Ga0501083_0003280 | Ga0501083_0003280_3820_4809 | 329 |
| 115 | 3300049824 | Ga0501045_0215409 | Ga0501045_0215409_250_1245 | 329 |
| 116 | 3300050508 | nmdc:mga09592_231416_c1 | nmdc:mga09592_231416_c1_157_1176 | 329 |
| 117 | 3300050511 | nmdc:mga08y16_19_c1 | nmdc:mga08y16_19_c1_215158_216177 | 329 |
| 118 | 3300050512 | nmdc:mga0n895_268203_c1 | nmdc:mga0n895_268203_c1_715_1704 | 329 |
| 119 | 3300050513 | nmdc:mga0rr50_231532_c1 | nmdc:mga0rr50_231532_c1_24_1040 | 329 |
| 120 | 3300053083 | Ga0495655_0048509 | Ga0495655_0048509_38_1057 | 329 |
| 121 | 3300003322 | rootL2_10246511 | rootL2_102465114 | 330 |
| 122 | 3300005330 | Ga0070690_100336867 | Ga0070690_1003368671 | 330 |
| 123 | 3300005331 | Ga0070670_100000204 | Ga0070670_10000020428 | 330 |
| 124 | 3300005338 | Ga0068868_100115582 | Ga0068868_1001155822 | 330 |
| 125 | 3300005436 | Ga0070713_100031508 | Ga0070713_1000315083 | 330 |
| 126 | 3300005436 | Ga0070713_100104079 | Ga0070713_1001040792 | 330 |
| 127 | 3300005535 | Ga0070684_100000094 | Ga0070684_10000009410 | 330 |
| 128 | 3300005547 | Ga0070693_100044932 | Ga0070693_1000449322 | 330 |
| 129 | 3300005578 | Ga0068854_100006138 | Ga0068854_1000061385 | 330 |
| 130 | 3300006028 | Ga0070717_10000086 | Ga0070717_1000008622 | 330 |
| 131 | 3300006237 | Ga0097621_100250206 | Ga0097621_1002502062 | 330 |
| 132 | 3300006847 | Ga0075431_100000720 | Ga0075431_1000007205 | 330 |
| 133 | 3300006914 | Ga0075436_100001228 | Ga0075436_1000012289 | 330 |
| 134 | 3300007076 | Ga0075435_100000308 | Ga0075435_10000030820 | 330 |
| 135 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011449 | 330 |
| 136 | 3300013105 | Ga0157369_10000957 | Ga0157369_100009576 | 330 |
| 137 | 3300013296 | Ga0157374_10000005 | Ga0157374_10000005112 | 330 |
| 138 | 3300013308 | Ga0157375_10000120 | Ga0157375_1000012010 | 330 |
| 139 | 3300014745 | Ga0157377_10000001 | Ga0157377_10000001461 | 330 |
| 140 | 3300014969 | Ga0157376_10000011 | Ga0157376_1000001175 | 330 |
| 141 | 3300025903 | Ga0207680_10034595 | Ga0207680_100345952 | 330 |
| 142 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012485 | 330 |
| 143 | 3300025925 | Ga0207650_10000021 | Ga0207650_10000021265 | 330 |
| 144 | 3300025928 | Ga0207700_10057524 | Ga0207700_100575243 | 330 |
| 145 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007266 | 330 |
| 146 | 3300025981 | Ga0207640_10002729 | Ga0207640_100027296 | 330 |
| 147 | 3300026023 | Ga0207677_10000607 | Ga0207677_1000060722 | 330 |
| 148 | 3300026078 | Ga0207702_10116258 | Ga0207702_101162582 | 330 |
| 149 | 3300026078 | Ga0207702_10544520 | Ga0207702_105445201 | 330 |
| 150 | 3300031251 | Ga0265327_10007004 | Ga0265327_100070044 | 330 |
| 151 | 3300031344 | Ga0265316_10113545 | Ga0265316_101135452 | 330 |
| 152 | 3300031691 | Ga0316579_10009528 | Ga0316579_100095283 | 330 |
| 153 | 3300031691 | Ga0316579_10080698 | Ga0316579_100806982 | 330 |
| 154 | 3300031727 | Ga0316576_10000801 | Ga0316576_100008017 | 330 |
| 155 | 3300031727 | Ga0316576_10011471 | Ga0316576_100114712 | 330 |
| 156 | 3300031727 | Ga0316576_10013040 | Ga0316576_100130404 | 330 |
| 157 | 3300031727 | Ga0316576_10084729 | Ga0316576_100847291 | 330 |
| 158 | 3300031727 | Ga0316576_10096546 | Ga0316576_100965462 | 330 |
| 159 | 3300031727 | Ga0316576_10156314 | Ga0316576_101563141 | 330 |
| 160 | 3300031728 | Ga0316578_10067096 | Ga0316578_100670962 | 330 |
| 161 | 3300031733 | Ga0316577_10002082 | Ga0316577_100020829 | 330 |
| 162 | 3300031733 | Ga0316577_10020957 | Ga0316577_100209572 | 330 |
| 163 | 3300031733 | Ga0316577_10029622 | Ga0316577_100296223 | 330 |
| 164 | 3300031733 | Ga0316577_10034535 | Ga0316577_100345352 | 330 |
| 165 | 3300031733 | Ga0316577_10074769 | Ga0316577_100747691 | 330 |
| 166 | 3300031733 | Ga0316577_10191582 | Ga0316577_101915821 | 330 |
| 167 | 3300032133 | Ga0316583_10002751 | Ga0316583_100027513 | 330 |
| 168 | 3300035398 | Ga0316574_0224944 | Ga0316574_0224944_170_1162 | 330 |
| 169 | 3300035724 | Ga0373933_0154418 | Ga0373933_0154418_241_1233 | 330 |
| 170 | 3300036647 | Ga0316582_0010296 | Ga0316582_0010296_3183_4187 | 330 |
| 171 | 3300036647 | Ga0316582_0029676 | Ga0316582_0029676_190_1194 | 330 |
| 172 | 3300036647 | Ga0316582_0112329 | Ga0316582_0112329_295_1299 | 330 |
| 173 | 3300036712 | Ga0316584_0000075 | Ga0316584_0000075_4641_5642 | 330 |
| 174 | 3300036712 | Ga0316584_0000863 | Ga0316584_0000863_10793_11797 | 330 |
| 175 | 3300036712 | Ga0316584_0025511 | Ga0316584_0025511_3279_4271 | 330 |
| 176 | 3300036712 | Ga0316584_0045772 | Ga0316584_0045772_1693_2697 | 330 |
| 177 | 3300036712 | Ga0316584_0112712 | Ga0316584_0112712_1017_2021 | 330 |
| 178 | 3300036712 | Ga0316584_0117948 | Ga0316584_0117948_929_1921 | 330 |
| 179 | 3300036712 | Ga0316584_0203410 | Ga0316584_0203410_454_1446 | 330 |
| 180 | 3300037471 | Ga0395905_0074093 | Ga0395905_0074093_54_1055 | 330 |
| 181 | 3300037588 | Ga0316581_0011617 | Ga0316581_0011617_802_1806 | 330 |
| 182 | 3300037588 | Ga0316581_0018506 | Ga0316581_0018506_889_1893 | 330 |
| 183 | 3300039437 | Ga0436365_0653168 | Ga0436365_0653168_5604_6641 | 330 |
| 184 | 3300039437 | Ga0436365_1816191 | Ga0436365_1816191_858_1898 | 330 |
| 185 | 3300042876 | Ga0451577_0155594 | Ga0451577_0155594_498_1490 | 330 |
| 186 | 3300044712 | Ga0453684_0572424 | Ga0453684_0572424_236_1228 | 330 |
| 187 | 3300045051 | Ga0451576_0012468 | Ga0451576_0012468_1618_2610 | 330 |
| 188 | 3300046516 | Ga0495628_0254073 | Ga0495628_0254073_299_1291 | 330 |
| 189 | 3300050510 | nmdc:mga06r32_121058_c1 | nmdc:mga06r32_121058_c1_957_1985 | 330 |
| 190 | 3300050513 | nmdc:mga0rr50_232_c1 | nmdc:mga0rr50_232_c1_4164_5189 | 330 |
| 191 | 3300050514 | nmdc:mga08x19_1023_c1 | nmdc:mga08x19_1023_c1_3312_4352 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hnk-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form | 0.9476 | 4 | 329 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9414 | 4 | 329 |
| 1hnk-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form | 0.9408 | 4 | 329 |
| 8d1u-assembly1.cif.gz_A | e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) with an acetylated cysteine and in complex with oxa(dethia)-coenzyme a | 0.9394 | 3 | 329 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9373 | 4 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hnkA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9728 | 232 | 329 | 3.40.47.10 |
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9288 | 4 | 329 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9256 | 4 | 330 | 3.40.47.10 |
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9231 | 4 | 329 | 3.40.47.10 |
| 4x9oB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9178 | 3 | 329 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3LA38-F1-model_v4 | 3-ketoacyl-ACP synthase | 0.9772 | 1 | 329 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A3D3FIE3-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein | 0.9746 | 132 | 328 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A1V5QVP9-F1-model_v4 | 3-oxoacyl-(Acyl-carrier-protein) synthase 3 (EC 2.3.1.180) | 0.9742 | 236 | 329 |
GO:0033818
GO:0044550 |
| AF-A0A7C8DUA1-F1-model_v4 | Ketoacyl-ACP synthase III | 0.9738 | 228 | 328 |
GO:0016746
|
| AF-A0A353RQ49-F1-model_v4 | Ketoacyl-ACP synthase III | 0.9733 | 1 | 196 |
GO:0004315
GO:0006633 GO:0044550 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar