F294027

General Info

Members Datasets Scaffolds Average Seq Length
191 151 179 250

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10154428|Ga0157373_101544282
Length 282
Sequence MISIILFFGKTQLFCYCKKALFVLPVKIKVMKRAENKVVVITGGALGIGRETSILLANEGANVAITDVLDKEGERLAQKINESGGTAKFWHLDVTNEKQAEYVFEDVVKEFGKLDALVNNAGISGANKPTHELTEQEWDTLMNVNVKGVFFCTKYAVQQMLKNGSGSIVNLSSIYGLIGAGDAPPYHASKGAVRLMAKNDAIIYAKNKIRVNSIHPGFITTPMVENFAKDTPDIMDYLATLHPLGHLGEPLDIAYGILYLVSDESKFVTGSELVIDGGYTAR

Samples

Sample ID Description Type Environment
1 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
2 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
3 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
4 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
5 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
6 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
7 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
8 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
9 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
10 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
136 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
151 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 2.09
Rhizoplane 1.57
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10004426 3300005293 Bacteria 8661
2 Ga0070690_100407159 3300005330 Bacteria 1000
3 Ga0070680_100032290 3300005336 Bacteria 4214
4 Ga0070660_100005653 3300005339 Bacteria 8664
5 Ga0070687_100179871 3300005343 Bacteria 1266
6 Ga0070692_10015128 3300005345 Bacteria 3642
7 Ga0070703_10000594 3300005406 Bacteria 13033
8 Ga0070714_100452245 3300005435 Bacteria 1220
9 Ga0070694_100399536 3300005444 Bacteria 1076
10 Ga0070694_100601583 3300005444 Bacteria 885
11 Ga0070708_100084129 3300005445 Bacteria 2885
12 Ga0070681_10017426 3300005458 Bacteria 7179
13 Ga0070681_10134139 3300005458 Bacteria 2407
14 Ga0068867_100401327 3300005459 Bacteria 1156
15 Ga0070706_100005340 3300005467 Bacteria 12242
16 Ga0070707_100269197 3300005468 Bacteria 1657
17 Ga0070698_100150954 3300005471 Bacteria 2271
18 Ga0070699_100497018 3300005518 Bacteria 1108
19 Ga0070679_100159921 3300005530 Bacteria 2227
20 Ga0070679_100455296 3300005530 Bacteria 1224
21 Ga0070679_100786564 3300005530 Bacteria 895
22 Ga0070697_100017392 3300005536 Bacteria 5657
23 Ga0068853_100009853 3300005539 Bacteria 7712
24 Ga0070695_100090448 3300005545 Bacteria 2042
25 Ga0070696_100007100 3300005546 Bacteria 7479
26 Ga0070696_100021319 3300005546 Bacteria 4393
27 Ga0070693_100268834 3300005547 Bacteria 1137
28 Ga0070704_100003389 3300005549 Bacteria 9134
29 Ga0070704_100175329 3300005549 Bacteria 1709
30 Ga0070704_100364471 3300005549 Bacteria 1223
31 Ga0068855_100054951 3300005563 Bacteria 4678
32 Ga0068855_100078555 3300005563 Bacteria 3828
33 Ga0068855_100086456 3300005563 Bacteria 3626
34 Ga0068857_100121716 3300005577 Bacteria 2350
35 Ga0068857_100223182 3300005577 Bacteria 1722
36 Ga0068857_100436074 3300005577 Bacteria 1223
37 Ga0068854_100002405 3300005578 Bacteria 11547
38 Ga0068856_100121835 3300005614 Bacteria 2610
39 Ga0068852_100308503 3300005616 Bacteria 1534
40 Ga0068859_100361223 3300005617 Bacteria 1547
41 Ga0068859_100938806 3300005617 Bacteria 949
42 Ga0068851_10002703 3300005834 Bacteria 7817
43 Ga0068858_100104728 3300005842 Bacteria 2640
44 Ga0068860_100068977 3300005843 Bacteria 3360
45 Ga0075362_10158995 3300006177 Unclassified 1087
46 Ga0075370_10021094 3300006353 Bacteria 3568
47 Ga0075428_100136875 3300006844 Bacteria 2663
48 Ga0075431_100004567 3300006847 Bacteria 13595
49 Ga0075434_100060729 3300006871 Bacteria 3760
50 Ga0075429_100001268 3300006880 Bacteria 20551
51 Ga0097620_100361230 3300006931 Bacteria 1547
52 Ga0097620_100938730 3300006931 Bacteria 949
53 Ga0105240_10047108 3300009093 Bacteria 5457
54 Ga0114129_10002047 3300009147 Bacteria 27666
55 Ga0105243_10500353 3300009148 Bacteria 1151
56 Ga0105241_10166907 3300009174 Bacteria 1815
57 Ga0105248_10247537 3300009177 Bacteria 2006
58 Ga0105237_10014035 3300009545 Bacteria 8380
59 Ga0105237_10073303 3300009545 Bacteria 3416
60 Ga0105238_10043814 3300009551 Bacteria 4527
61 Ga0105238_10314310 3300009551 Bacteria 1552
62 Ga0105249_11306371 3300009553 Bacteria 797
63 Ga0105239_10002552 3300010375 Bacteria 23093
64 Ga0105239_10044485 3300010375 Bacteria 4867
65 Ga0157373_10154428 3300013100 Bacteria 1615
66 Ga0157373_10294991 3300013100 Bacteria 1150
67 Ga0157371_10001178 3300013102 Bacteria 28068
68 Ga0157371_10004421 3300013102 Bacteria 12276
69 Ga0157369_10052964 3300013105 Bacteria 4388
70 Ga0157378_10169182 3300013297 Bacteria 2048
71 Ga0157372_10223703 3300013307 Unclassified 2182
72 Ga0157376_10024749 3300014969 Bacteria 4719
73 Ga0157376_10347018 3300014969 Bacteria 1419
74 Ga0207656_10128958 3300025321 Unclassified 1183
75 Ga0207653_10000075 3300025885 Bacteria 73038
76 Ga0207647_10013967 3300025904 Bacteria 5556
77 Ga0207699_10410804 3300025906 Bacteria 965
78 Ga0207643_10095325 3300025908 Bacteria 1739
79 Ga0207684_10023413 3300025910 Bacteria 5274
80 Ga0207707_10139155 3300025912 Bacteria 2122
81 Ga0207695_10009061 3300025913 Bacteria 12365
82 Ga0207671_10002849 3300025914 Bacteria 17948
83 Ga0207660_10020963 3300025917 Bacteria 4391
84 Ga0207660_10023645 3300025917 Bacteria 4153
85 Ga0207657_10008919 3300025919 Bacteria 10133
86 Ga0207652_10434523 3300025921 Bacteria 1184
87 Ga0207646_10260740 3300025922 Bacteria 1566
88 Ga0207694_10034601 3300025924 Bacteria 3874
89 Ga0207667_10023146 3300025949 Bacteria 6843
90 Ga0207667_10175350 3300025949 Bacteria 2203
91 Ga0207640_10032301 3300025981 Bacteria 3244
92 Ga0207703_10483952 3300026035 Bacteria 1160
93 Ga0207639_10006903 3300026041 Bacteria 7732
94 Ga0207702_10048054 3300026078 Bacteria 3598
95 Ga0207674_10018151 3300026116 Bacteria 7655
96 Ga0207674_10065317 3300026116 Bacteria 3668
97 Ga0207674_10072268 3300026116 Bacteria 3465
98 Ga0207674_10153815 3300026116 Bacteria 2256
99 Ga0207675_100042483 3300026118 Bacteria 4245
100 Ga0268264_10054335 3300028381 Bacteria 3344
101 Ga0265327_10002651 3300031251 Bacteria 18419
102 Ga0307408_100019024 3300031548 Bacteria 4619
103 Ga0316576_10038062 3300031727 Bacteria 3447
104 Ga0307405_10023877 3300031731 Bacteria 3483
105 Ga0307405_10540764 3300031731 Bacteria 941
106 Ga0307413_10086938 3300031824 Bacteria 2023
107 Ga0307406_10084610 3300031901 Bacteria 2118
108 Ga0307412_10008972 3300031911 Bacteria 5728
109 Ga0307412_10093490 3300031911 Bacteria 2109
110 Ga0307416_100103052 3300032002 Bacteria 2490
111 Ga0307414_10151725 3300032004 Bacteria 1829
112 Ga0316574_0012998 3300035398 Bacteria 4776
113 Ga0316574_0120865 3300035398 Bacteria 1682
114 Ga0373931_0189003 3300035691 Bacteria 1224
115 Ga0316584_0058781 3300036712 Bacteria 2879
116 Ga0395899_0006444 3300037312 Bacteria 9094
117 Ga0395900_0014314 3300037418 Bacteria 8097
118 Ga0395900_0336263 3300037418 Bacteria 1487
119 Ga0395898_0004980 3300037466 Bacteria 14405
120 Ga0395898_0272564 3300037466 Bacteria 1614
121 Ga0436361_0139021 3300039447 Bacteria 59763
122 Ga0436361_0183946 3300039447 Bacteria 17012
123 Ga0436361_0759615 3300039447 Bacteria 5211
124 Ga0436362_0885108 3300039453 Bacteria 1030
125 Ga0451577_0106865 3300042876 Bacteria 2502
126 Ga0495638_0131610 3300046460 Bacteria 1469
127 Ga0495618_0000223 3300046514 Bacteria 41437
128 Ga0495665_0233072 3300046531 Bacteria 950
129 Ga0495640_0150233 3300046533 Bacteria 1497
130 Ga0495625_0108028 3300046660 Bacteria 1904
131 Ga0495625_0231041 3300046660 Bacteria 1208
132 Ga0495635_0020075 3300046663 Bacteria 4657
133 Ga0495674_0109637 3300047319 Bacteria 2341
134 Ga0495680_0120679 3300047322 Bacteria 1936
135 Ga0495680_0179312 3300047322 Bacteria 1530
136 Ga0495602_0399193 3300048088 Bacteria 981
137 Ga0496102_0204810 3300048905 Unclassified 1860
138 Ga0496114_0040238 3300048917 Bacteria 3869
139 Ga0496115_0007445 3300048918 Bacteria 8056
140 Ga0496117_0000396 3300048920 Bacteria 74325
141 Ga0496122_0011215 3300048925 Bacteria 9113
142 Ga0496123_0000376 3300048926 Bacteria 83875
143 Ga0496125_0000216 3300048928 Bacteria 117897
144 Ga0496126_0683638 3300048929 Bacteria 799
145 Ga0495682_0165898 3300049460 Bacteria 786
146 Ga0501031_0208020 3300049568 Bacteria 1275
147 Ga0501032_0006501 3300049569 Bacteria 8595
148 Ga0501040_0337927 3300049576 Bacteria 1078
149 Ga0501042_0107830 3300049578 Bacteria 2005
150 Ga0501043_0001908 3300049579 Bacteria 17873
151 Ga0501047_0000043 3300049581 Bacteria 175522
152 Ga0501048_0228485 3300049582 Bacteria 1320
153 Ga0501068_0106442 3300049584 Bacteria 1741
154 Ga0501068_0310571 3300049584 Bacteria 1010
155 Ga0501071_0096170 3300049587 Bacteria 2180
156 Ga0501071_0135776 3300049587 Bacteria 1830
157 Ga0501072_0057019 3300049588 Bacteria 3078
158 Ga0501072_0317959 3300049588 Bacteria 1237
159 Ga0501075_0030350 3300049591 Bacteria 4004
160 Ga0501075_0153578 3300049591 Bacteria 1755
161 Ga0501076_0063064 3300049592 Bacteria 2952
162 Ga0501208_005169 3300049655 Bacteria 1588
163 Ga0501249_000024 3300049679 Bacteria 92031
164 Ga0501079_0057133 3300049741 Bacteria 3011
165 Ga0501080_0263955 3300049742 Bacteria 1568
166 Ga0501035_0432814 3300049822 Bacteria 1091
167 Ga0501045_0416601 3300049824 Bacteria 999
168 nmdc:mga03683_23559_c1 3300050489 Unclassified 2399
169 nmdc:mga05p37_8190_c1 3300050507 Bacteria 12357
170 nmdc:mga09592_1589_c1 3300050508 Bacteria 18292
171 nmdc:mga06r32_4630_c1 3300050510 Bacteria 12338
172 Ga0500608_000098 3300053122 Bacteria 35436
173 Ga0500616_0001341 3300053153 Bacteria 24116
174 Ga0500616_0042147 3300053153 Bacteria 2445
175 Ga0500616_0081355 3300053153 Bacteria 1627
176 Ga0501084_0143986 3300054114 Bacteria 2007
177 Ga0501082_0452621 3300060353 Bacteria 1122
178 Ga0530510_0111230 3300061734 Bacteria 2006
179 Ga0530510_0180300 3300061734 Bacteria 1566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049460 Ga0495682_0165898 Ga0495682_0165898_45_665 199
2 3300053153 Ga0500616_0001341 Ga0500616_0001341_2531_3316 200
3 3300039447 Ga0436361_0759615 Ga0436361_0759615_57_698 208
4 3300014969 Ga0157376_10024749 Ga0157376_100247492 223
5 3300014969 Ga0157376_10347018 Ga0157376_103470181 223
6 3300046460 Ga0495638_0131610 Ga0495638_0131610_158_844 223
7 3300048929 Ga0496126_0683638 Ga0496126_0683638_62_748 223
8 3300053153 Ga0500616_0081355 Ga0500616_0081355_104_829 226
9 3300046531 Ga0495665_0233072 Ga0495665_0233072_33_737 227
10 3300048088 Ga0495602_0399193 Ga0495602_0399193_172_876 227
11 3300048920 Ga0496117_0000396 Ga0496117_0000396_68666_69454 229
12 3300047322 Ga0495680_0120679 Ga0495680_0120679_50_766 231
13 3300005563 Ga0068855_100086456 Ga0068855_1000864562 232
14 3300009545 Ga0105237_10014035 Ga0105237_100140358 232
15 3300009551 Ga0105238_10314310 Ga0105238_103143103 232
16 3300010375 Ga0105239_10002552 Ga0105239_1000255210 232
17 3300025914 Ga0207671_10002849 Ga0207671_1000284914 232
18 3300025949 Ga0207667_10175350 Ga0207667_101753502 232
19 3300047319 Ga0495674_0109637 Ga0495674_0109637_295_1080 232
20 iso_pu_bacteria 2874168670 2874171021 236
21 iso_pu_bacteria 2908811453 2908816346 237
22 3300025906 Ga0207699_10410804 Ga0207699_104108041 239
23 3300049568 Ga0501031_0208020 Ga0501031_0208020_21_743 239
24 3300060353 Ga0501082_0452621 Ga0501082_0452621_382_1104 239
25 3300006353 Ga0075370_10021094 Ga0075370_100210944 241
26 3300009093 Ga0105240_10047108 Ga0105240_100471087 241
27 3300009545 Ga0105237_10073303 Ga0105237_100733033 241
28 3300009551 Ga0105238_10043814 Ga0105238_100438144 241
29 3300010375 Ga0105239_10044485 Ga0105239_100444855 241
30 3300013105 Ga0157369_10052964 Ga0157369_100529643 241
31 3300013307 Ga0157372_10223703 Ga0157372_102237031 241
32 iso_pu_bacteria 3001892409 3001896659 241
33 iso_pu_bacteria 2857481737 2857483422 242
34 3300005339 Ga0070660_100005653 Ga0070660_1000056536 243
35 3300005435 Ga0070714_100452245 Ga0070714_1004522452 243
36 3300005563 Ga0068855_100054951 Ga0068855_1000549516 243
37 3300005614 Ga0068856_100121835 Ga0068856_1001218354 243
38 3300025913 Ga0207695_10009061 Ga0207695_100090616 243
39 3300025919 Ga0207657_10008919 Ga0207657_100089191 243
40 3300025924 Ga0207694_10034601 Ga0207694_100346012 243
41 3300025949 Ga0207667_10023146 Ga0207667_100231464 243
42 3300026078 Ga0207702_10048054 Ga0207702_100480543 243
43 3300036712 Ga0316584_0058781 Ga0316584_0058781_1073_1870 243
44 3300042876 Ga0451577_0106865 Ga0451577_0106865_866_1681 243
45 3300005539 Ga0068853_100009853 Ga0068853_1000098536 244
46 3300005577 Ga0068857_100121716 Ga0068857_1001217163 244
47 3300005577 Ga0068857_100436074 Ga0068857_1004360742 244
48 3300005578 Ga0068854_100002405 Ga0068854_1000024053 244
49 3300005616 Ga0068852_100308503 Ga0068852_1003085033 244
50 3300005834 Ga0068851_10002703 Ga0068851_100027033 244
51 3300009174 Ga0105241_10166907 Ga0105241_101669072 244
52 3300025321 Ga0207656_10128958 Ga0207656_101289582 244
53 3300025981 Ga0207640_10032301 Ga0207640_100323012 244
54 3300026041 Ga0207639_10006903 Ga0207639_100069033 244
55 3300026116 Ga0207674_10018151 Ga0207674_100181512 244
56 3300026116 Ga0207674_10072268 Ga0207674_100722682 244
57 3300026116 Ga0207674_10153815 Ga0207674_101538153 244
58 3300031548 Ga0307408_100019024 Ga0307408_1000190243 244
59 3300031731 Ga0307405_10023877 Ga0307405_100238773 244
60 3300031731 Ga0307405_10540764 Ga0307405_105407642 244
61 3300031824 Ga0307413_10086938 Ga0307413_100869382 244
62 3300031901 Ga0307406_10084610 Ga0307406_100846102 244
63 3300031911 Ga0307412_10008972 Ga0307412_100089723 244
64 3300031911 Ga0307412_10093490 Ga0307412_100934902 244
65 3300032002 Ga0307416_100103052 Ga0307416_1001030522 244
66 3300032004 Ga0307414_10151725 Ga0307414_101517252 244
67 3300049569 Ga0501032_0006501 Ga0501032_0006501_752_1498 244
68 3300049579 Ga0501043_0001908 Ga0501043_0001908_16801_17547 244
69 3300049581 Ga0501047_0000043 Ga0501047_0000043_77872_78618 244
70 3300049582 Ga0501048_0228485 Ga0501048_0228485_229_975 244
71 3300049655 Ga0501208_005169 Ga0501208_005169_514_1260 244
72 3300049679 Ga0501249_000024 Ga0501249_000024_57465_58211 244
73 iso_pu_bacteria 8016254467 8016256029 244
74 3300037418 Ga0395900_0336263 Ga0395900_0336263_499_1263 245
75 3300037466 Ga0395898_0272564 Ga0395898_0272564_396_1160 245
76 3300046660 Ga0495625_0108028 Ga0495625_0108028_495_1268 245
77 3300048917 Ga0496114_0040238 Ga0496114_0040238_302_1045 245
78 3300048918 Ga0496115_0007445 Ga0496115_0007445_2247_3020 245
79 3300048925 Ga0496122_0011215 Ga0496122_0011215_5594_6406 246
80 3300048926 Ga0496123_0000376 Ga0496123_0000376_77528_78340 246
81 3300048928 Ga0496125_0000216 Ga0496125_0000216_5592_6404 246
82 3300005459 Ga0068867_100401327 Ga0068867_1004013271 247
83 3300005617 Ga0068859_100361223 Ga0068859_1003612232 247
84 3300005842 Ga0068858_100104728 Ga0068858_1001047282 247
85 3300006931 Ga0097620_100361230 Ga0097620_1003612302 247
86 3300009177 Ga0105248_10247537 Ga0105248_102475373 247
87 3300026035 Ga0207703_10483952 Ga0207703_104839522 247
88 3300035691 Ga0373931_0189003 Ga0373931_0189003_200_967 247
89 3300039447 Ga0436361_0139021 Ga0436361_0139021_3292_4065 247
90 3300039447 Ga0436361_0183946 Ga0436361_0183946_16172_16945 247
91 3300039453 Ga0436362_0885108 Ga0436362_0885108_120_893 247
92 3300046660 Ga0495625_0231041 Ga0495625_0231041_103_861 247
93 3300048905 Ga0496102_0204810 Ga0496102_0204810_369_1136 247
94 3300053122 Ga0500608_000098 Ga0500608_000098_26787_27554 247
95 3300005563 Ga0068855_100078555 Ga0068855_1000785553 248
96 3300006177 Ga0075362_10158995 Ga0075362_101589952 248
97 3300013100 Ga0157373_10154428 Ga0157373_101544282 248
98 3300013102 Ga0157371_10001178 Ga0157371_100011786 248
99 3300013102 Ga0157371_10004421 Ga0157371_100044212 248
100 3300013297 Ga0157378_10169182 Ga0157378_101691822 248
101 3300025904 Ga0207647_10013967 Ga0207647_100139675 248
102 3300026118 Ga0207675_100042483 Ga0207675_1000424835 248
103 3300031251 Ga0265327_10002651 Ga0265327_100026512 248
104 3300031727 Ga0316576_10038062 Ga0316576_100380624 248
105 3300035398 Ga0316574_0012998 Ga0316574_0012998_121_960 248
106 3300035398 Ga0316574_0120865 Ga0316574_0120865_361_1140 248
107 3300037312 Ga0395899_0006444 Ga0395899_0006444_6069_6827 248
108 3300037418 Ga0395900_0014314 Ga0395900_0014314_6879_7637 248
109 3300037466 Ga0395898_0004980 Ga0395898_0004980_7381_8139 248
110 3300046514 Ga0495618_0000223 Ga0495618_0000223_4071_4838 248
111 3300046533 Ga0495640_0150233 Ga0495640_0150233_269_1036 248
112 3300046663 Ga0495635_0020075 Ga0495635_0020075_1993_2760 248
113 3300047322 Ga0495680_0179312 Ga0495680_0179312_614_1381 248
114 3300050489 nmdc:mga03683_23559_c1 nmdc:mga03683_23559_c1_103_906 248
115 3300053153 Ga0500616_0042147 Ga0500616_0042147_1564_2337 248
116 iso_pu_bacteria 2744054900 2746091327 248
117 iso_pu_bacteria 2744054901 2746097760 248
118 iso_pu_bacteria 2842324504 2842325273 248
119 iso_pu_bacteria 2842348783 2842349552 248
120 iso_pu_bacteria 2842454564 2842455210 248
121 iso_pu_bacteria 2900634093 2900640248 248
122 iso_pu_bacteria 8057345674 8057349399 248
123 3300005293 Ga0065715_10004426 Ga0065715_100044263 249
124 3300005330 Ga0070690_100407159 Ga0070690_1004071591 249
125 3300005336 Ga0070680_100032290 Ga0070680_1000322902 249
126 3300005343 Ga0070687_100179871 Ga0070687_1001798713 249
127 3300005345 Ga0070692_10015128 Ga0070692_100151282 249
128 3300005406 Ga0070703_10000594 Ga0070703_100005943 249
129 3300005444 Ga0070694_100399536 Ga0070694_1003995361 249
130 3300005444 Ga0070694_100601583 Ga0070694_1006015831 249
131 3300005445 Ga0070708_100084129 Ga0070708_1000841293 249
132 3300005458 Ga0070681_10017426 Ga0070681_100174262 249
133 3300005458 Ga0070681_10134139 Ga0070681_101341393 249
134 3300005467 Ga0070706_100005340 Ga0070706_1000053402 249
135 3300005468 Ga0070707_100269197 Ga0070707_1002691972 249
136 3300005471 Ga0070698_100150954 Ga0070698_1001509542 249
137 3300005518 Ga0070699_100497018 Ga0070699_1004970181 249
138 3300005530 Ga0070679_100159921 Ga0070679_1001599212 249
139 3300005530 Ga0070679_100455296 Ga0070679_1004552961 249
140 3300005530 Ga0070679_100786564 Ga0070679_1007865641 249
141 3300005536 Ga0070697_100017392 Ga0070697_1000173929 249
142 3300005545 Ga0070695_100090448 Ga0070695_1000904482 249
143 3300005546 Ga0070696_100007100 Ga0070696_1000071003 249
144 3300005546 Ga0070696_100021319 Ga0070696_1000213192 249
145 3300005547 Ga0070693_100268834 Ga0070693_1002688342 249
146 3300005549 Ga0070704_100003389 Ga0070704_1000033896 249
147 3300005549 Ga0070704_100175329 Ga0070704_1001753292 249
148 3300005549 Ga0070704_100364471 Ga0070704_1003644711 249
149 3300005577 Ga0068857_100223182 Ga0068857_1002231823 249
150 3300005617 Ga0068859_100938806 Ga0068859_1009388062 249
151 3300005843 Ga0068860_100068977 Ga0068860_1000689774 249
152 3300006844 Ga0075428_100136875 Ga0075428_1001368751 249
153 3300006847 Ga0075431_100004567 Ga0075431_10000456717 249
154 3300006871 Ga0075434_100060729 Ga0075434_1000607292 249
155 3300006880 Ga0075429_100001268 Ga0075429_10000126821 249
156 3300006931 Ga0097620_100938730 Ga0097620_1009387302 249
157 3300009147 Ga0114129_10002047 Ga0114129_1000204720 249
158 3300009148 Ga0105243_10500353 Ga0105243_105003532 249
159 3300009553 Ga0105249_11306371 Ga0105249_113063711 249
160 3300013100 Ga0157373_10294991 Ga0157373_102949912 249
161 3300025885 Ga0207653_10000075 Ga0207653_1000007527 249
162 3300025908 Ga0207643_10095325 Ga0207643_100953252 249
163 3300025910 Ga0207684_10023413 Ga0207684_100234132 249
164 3300025912 Ga0207707_10139155 Ga0207707_101391553 249
165 3300025917 Ga0207660_10020963 Ga0207660_100209635 249
166 3300025917 Ga0207660_10023645 Ga0207660_100236453 249
167 3300025921 Ga0207652_10434523 Ga0207652_104345232 249
168 3300025922 Ga0207646_10260740 Ga0207646_102607403 249
169 3300026116 Ga0207674_10065317 Ga0207674_100653173 249
170 3300028381 Ga0268264_10054335 Ga0268264_100543352 249
171 3300049576 Ga0501040_0337927 Ga0501040_0337927_142_897 249
172 3300049578 Ga0501042_0107830 Ga0501042_0107830_241_996 249
173 3300049584 Ga0501068_0106442 Ga0501068_0106442_122_883 249
174 3300049584 Ga0501068_0310571 Ga0501068_0310571_59_820 249
175 3300049587 Ga0501071_0096170 Ga0501071_0096170_365_1120 249
176 3300049587 Ga0501071_0135776 Ga0501071_0135776_637_1398 249
177 3300049588 Ga0501072_0057019 Ga0501072_0057019_2129_2890 249
178 3300049588 Ga0501072_0317959 Ga0501072_0317959_424_1185 249
179 3300049591 Ga0501075_0030350 Ga0501075_0030350_513_1268 249
180 3300049591 Ga0501075_0153578 Ga0501075_0153578_960_1715 249
181 3300049592 Ga0501076_0063064 Ga0501076_0063064_1034_1789 249
182 3300049741 Ga0501079_0057133 Ga0501079_0057133_1210_1965 249
183 3300049742 Ga0501080_0263955 Ga0501080_0263955_22_783 249
184 3300049822 Ga0501035_0432814 Ga0501035_0432814_42_797 249
185 3300049824 Ga0501045_0416601 Ga0501045_0416601_45_806 249
186 3300050507 nmdc:mga05p37_8190_c1 nmdc:mga05p37_8190_c1_3947_4696 249
187 3300050508 nmdc:mga09592_1589_c1 nmdc:mga09592_1589_c1_14477_15226 249
188 3300050510 nmdc:mga06r32_4630_c1 nmdc:mga06r32_4630_c1_4297_5046 249
189 3300054114 Ga0501084_0143986 Ga0501084_0143986_594_1355 249
190 3300061734 Ga0530510_0111230 Ga0530510_0111230_575_1336 249
191 3300061734 Ga0530510_0180300 Ga0530510_0180300_683_1438 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

37

232

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

280

0.96

PF08659

KR

KR domain

37

201

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9757 3 245
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9702 3 249
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9685 4 249
6y4d-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with nadp+ 0.9675 3 248
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9671 4 249
ID Description Score Start End Superfamily
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 3 249 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 4 249 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9677 59 179 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 81 246 3.40.50.720
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 3 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M8P8P9-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9763 1 249 GO:0047936
AF-A0A3M1QB26-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9763 2 249 GO:0047936
AF-A0A516SCK0-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9742 3 246 GO:0016491
AF-A0A0S7XKD8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9736 3 249 GO:0016616
GO:0030497
AF-A0A2E5PH56-F1-model_v4 Cyclopentanol dehydrogenase 0.9729 1 249 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.02 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map