F294000

General Info

Members Datasets Scaffolds Average Seq Length
191 142 382 337

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10022798|Ga0105248_100227986
Length 386
Sequence LQSGIVAFSSQIHRDKETQRKWLSTMVTSREIRLKSRPVGMPSAENFELATVSVPHPVPGQVQVHNLWMTVDPYMRGRMAERASYTPSSQPGREVHGSTIRPIAASNATMYGWRPPFQLGEALDGGAIGEVAVSEDPRFKPGDLVSSWLGWREWFNAPAEILQKLDTFGLPPQAFLGVAGMPGLTAWVGLLKIATLKPGDVVFVSAASGSVGSAVCQIAKLKGHTVIGSAGGAAKCAFLKQIGVDNVIDYKVVGDLTEALLNAAPTGIDVYFENVGGEHLEAALAAANPFARISLCGMISQYNAITLPDGPRNIMFVMGKSLRLEGFNIADYLDLMPEFQKEMSGWIHEGKVRWKETIEHGIENAPAAFLKLFKGENFGKMVVKLR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
139 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
140 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
141 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
142 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 4.19
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 0
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10022798 3300009177 Bacteria 6949
2 Ga0032354_1033400 3300003693 Bacteria 1942
3 Ga0055528_1003024 3300003790 Eukaryota 8669
4 Ga0055531_10045198 3300003794 Bacteria 1225
5 Ga0070666_10001194 3300005335 Bacteria 15727
6 Ga0068868_100133970 3300005338 Bacteria 2030
7 Ga0070668_100095729 3300005347 Bacteria 2346
8 Ga0070674_100117921 3300005356 Bacteria 1960
9 Ga0070667_100016368 3300005367 Bacteria 6135
10 Ga0070708_100111817 3300005445 Bacteria 2511
11 Ga0070678_100130657 3300005456 Bacteria 1995
12 Ga0070662_100040723 3300005457 Bacteria 3309
13 Ga0068867_100090081 3300005459 Bacteria 2326
14 Ga0070698_100124386 3300005471 Bacteria 2536
15 Ga0070679_100118613 3300005530 Bacteria 2631
16 Ga0070693_100046813 3300005547 Bacteria 2458
17 Ga0070665_100054985 3300005548 Bacteria 3992
18 Ga0068855_100024817 3300005563 Bacteria 7172
19 Ga0068861_100038071 3300005719 Unclassified 3578
20 Ga0068863_100093479 3300005841 Bacteria 2854
21 Ga0068858_100004340 3300005842 Bacteria 13920
22 Ga0068858_100333482 3300005842 Bacteria 1451
23 Ga0068860_100150074 3300005843 Bacteria 2244
24 Ga0081455_10000563 3300005937 Bacteria 48309
25 Ga0070715_10049060 3300006163 Bacteria 1808
26 Ga0070716_100018037 3300006173 Bacteria 3671
27 Ga0068871_100092469 3300006358 Bacteria 2523
28 Ga0114129_10166789 3300009147 Bacteria 3005
29 Ga0105243_10120516 3300009148 Bacteria 2211
30 Ga0105241_10028205 3300009174 Bacteria 4183
31 Ga0105242_10099139 3300009176 Bacteria 2466
32 Ga0105238_10059274 3300009551 Bacteria 3835
33 Ga0105249_10059179 3300009553 Bacteria 3513
34 Ga0105239_10150844 3300010375 Bacteria 2594
35 Ga0157373_10000586 3300013100 Bacteria 28347
36 Ga0157369_10092442 3300013105 Bacteria 3229
37 Ga0157374_10061233 3300013296 Bacteria 3524
38 Ga0157374_10559530 3300013296 Bacteria 1152
39 Ga0163162_10032128 3300013306 Bacteria 5212
40 Ga0157375_10159196 3300013308 Bacteria 2399
41 Ga0157380_10023129 3300014326 Bacteria 4686
42 Ga0157379_10000600 3300014968 Bacteria 29076
43 Ga0163161_10034512 3300017792 Bacteria 3620
44 Ga0197907_11278329 3300020069 Bacteria 1135
45 Ga0206356_10671048 3300020070 Bacteria 1932
46 Ga0206350_10000923 3300020080 Bacteria 1134
47 Ga0206354_10703792 3300020081 Bacteria 5216
48 Ga0206354_11523524 3300020081 Bacteria 1141
49 Ga0206353_10972529 3300020082 Bacteria 1399
50 Ga0206353_11371763 3300020082 Bacteria 14727
51 Ga0213876_10053380 3300021384 Bacteria 2135
52 Ga0213875_10011319 3300021388 Bacteria 4440
53 Ga0209673_1001688 3300025273 Eukaryota 18838
54 Ga0209257_1000561 3300025304 Bacteria 63214
55 Ga0207653_10054410 3300025885 Bacteria 1338
56 Ga0207680_10002048 3300025903 Bacteria 9445
57 Ga0207671_10089215 3300025914 Bacteria 2320
58 Ga0207646_10010524 3300025922 Bacteria 9027
59 Ga0207706_10045300 3300025933 Bacteria 3898
60 Ga0207709_10089118 3300025935 Bacteria 2011
61 Ga0207669_10068455 3300025937 Bacteria 2217
62 Ga0207665_10012025 3300025939 Bacteria 5683
63 Ga0207691_10367814 3300025940 Bacteria 1228
64 Ga0207667_10098202 3300025949 Bacteria 3022
65 Ga0207712_10045577 3300025961 Bacteria 3037
66 Ga0207658_10056846 3300025986 Bacteria 2905
67 Ga0207677_10160641 3300026023 Bacteria 1745
68 Ga0207703_10002997 3300026035 Bacteria 14319
69 Ga0207648_10138929 3300026089 Bacteria 2141
70 Ga0207675_100068709 3300026118 Bacteria 3311
71 Ga0207675_100073621 3300026118 Unclassified 3196
72 Ga0268264_10274009 3300028381 Bacteria 1577
73 Ga0265338_10020496 3300028800 Bacteria 6952
74 Ga0265325_10001517 3300031241 Bacteria 16311
75 Ga0265325_10001760 3300031241 Bacteria 15000
76 Ga0265339_10001275 3300031249 Bacteria 18847
77 Ga0265327_10001063 3300031251 Bacteria 38305
78 Ga0265316_10005230 3300031344 Bacteria 12682
79 Ga0265316_10013722 3300031344 Bacteria 7181
80 Ga0307408_100240542 3300031548 Bacteria 1487
81 Ga0265313_10003340 3300031595 Bacteria 13113
82 Ga0265313_10004491 3300031595 Bacteria 10677
83 Ga0307514_10036668 3300031649 Bacteria 3896
84 Ga0307516_10000004 3300031730 Bacteria 367451
85 Ga0307405_10158078 3300031731 Bacteria 1602
86 Ga0307410_10138658 3300031852 Bacteria 1796
87 Ga0307406_10089023 3300031901 Bacteria 2072
88 Ga0307407_10042716 3300031903 Bacteria 2544
89 Ga0307407_10109882 3300031903 Bacteria 1729
90 Ga0307407_10290941 3300031903 Bacteria 1135
91 Ga0307409_100041671 3300031995 Bacteria 3431
92 Ga0307409_100045574 3300031995 Bacteria 3311
93 Ga0307409_100073694 3300031995 Bacteria 2724
94 Ga0307409_100106339 3300031995 Bacteria 2342
95 Ga0307416_100074412 3300032002 Bacteria 2837
96 Ga0307416_100107397 3300032002 Bacteria 2449
97 Ga0307414_10084377 3300032004 Bacteria 2336
98 Ga0373955_0156422 3300035172 Bacteria 1343
99 Ga0373937_0212846 3300036401 Bacteria 1819
100 Ga0436364_0751994 3300037853 Bacteria 7220
101 Ga0395901_0298100 3300038443 Bacteria 1672
102 Ga0436365_1267898 3300039437 Bacteria 1334
103 Ga0466966_0027882 3300044684 Bacteria 3681
104 Ga0466961_0100013 3300044693 Bacteria 1827
105 Ga0466961_0100680 3300044693 Bacteria 1820
106 Ga0466961_0188977 3300044693 Bacteria 1277
107 Ga0466963_0094467 3300044694 Bacteria 2039
108 Ga0466964_0037198 3300044706 Bacteria 1954
109 Ga0466957_0032615 3300044842 Bacteria 3120
110 Ga0466957_0036846 3300044842 Bacteria 2942
111 Ga0466960_0015540 3300044901 Bacteria 3283
112 Ga0466960_0048551 3300044901 Bacteria 2040
113 Ga0466959_0098374 3300045049 Bacteria 2096
114 Ga0466958_0065611 3300045836 Bacteria 2215
115 Ga0466967_0056536 3300045976 Bacteria 3460
116 Ga0466967_0058091 3300045976 Bacteria 3418
117 Ga0466967_0443582 3300045976 Bacteria 1268
118 Ga0495592_0070887 3300046454 Eukaryota 2538
119 Ga0495592_0181877 3300046454 Eukaryota 1431
120 Ga0495629_0031844 3300046459 Eukaryota 3734
121 Ga0495641_0001476 3300046461 Eukaryota 19988
122 Ga0495641_0010466 3300046461 Eukaryota 5370
123 Ga0495651_0033448 3300046462 Eukaryota 4010
124 Ga0495653_0090330 3300046463 Eukaryota 2242
125 Ga0495606_0027569 3300046507 Eukaryota 4025
126 Ga0495606_0028490 3300046507 Eukaryota 3940
127 Ga0495608_0000917 3300046511 Eukaryota 20663
128 Ga0495608_0053172 3300046511 Eukaryota 2680
129 Ga0495608_0136470 3300046511 Eukaryota 1567
130 Ga0495618_0002769 3300046514 Eukaryota 11142
131 Ga0495618_0008081 3300046514 Eukaryota 6371
132 Ga0495620_0003354 3300046515 Eukaryota 9183
133 Ga0495620_0009896 3300046515 Eukaryota 5048
134 Ga0495628_0000449 3300046516 Eukaryota 37534
135 Ga0495628_0032600 3300046516 Eukaryota 4204
136 Ga0495630_0045643 3300046517 Eukaryota 3275
137 Ga0495630_0072867 3300046517 Bacteria 2586
138 Ga0495652_0000633 3300046529 Eukaryota 40965
139 Ga0495652_0004432 3300046529 Eukaryota 13420
140 Ga0495652_0008934 3300046529 Eukaryota 9118
141 Ga0495587_0081998 3300046536 Eukaryota 1869
142 Ga0495645_0022330 3300046543 Eukaryota 4577
143 Ga0495645_0040594 3300046543 Bacteria 3394
144 Ga0495634_0042800 3300046642 Eukaryota 3071
145 Ga0495634_0142511 3300046642 Bacteria 1521
146 Ga0495635_0021623 3300046663 Eukaryota 4485
147 Ga0495635_0032114 3300046663 Eukaryota 3644
148 Ga0495661_0019565 3300046665 Eukaryota 4435
149 Ga0495657_0011975 3300046675 Eukaryota 6460
150 Ga0495657_0018830 3300046675 Eukaryota 4990
151 Ga0495623_0017069 3300046679 Eukaryota 4688
152 Ga0495623_0095853 3300046679 Eukaryota 1813
153 Ga0495646_0001366 3300046680 Eukaryota 14445
154 Ga0495646_0120945 3300046680 Eukaryota 1482
155 Ga0495669_0000927 3300046684 Bacteria 12269
156 Ga0495624_0001729 3300046690 Eukaryota 16686
157 Ga0495624_0008553 3300046690 Eukaryota 7129
158 Ga0495600_0058364 3300046809 Eukaryota 2521
159 Ga0495600_0074431 3300046809 Eukaryota 2218
160 Ga0495600_0179562 3300046809 Eukaryota 1364
161 Ga0495604_0007145 3300047317 Eukaryota 8846
162 Ga0495674_0006666 3300047319 Eukaryota 11065
163 Ga0495676_0000519 3300047321 Eukaryota 31570
164 Ga0495676_0003631 3300047321 Eukaryota 13998
165 Ga0495676_0009449 3300047321 Eukaryota 8881
166 Ga0495676_0073773 3300047321 Eukaryota 2615
167 Ga0495676_0260549 3300047321 Bacteria 1180
168 Ga0495680_0058043 3300047322 Eukaryota 2992
169 Ga0495680_0112271 3300047322 Eukaryota 2019
170 Ga0495677_0027230 3300047445 Bacteria 2074
171 Ga0495593_0061209 3300047673 Eukaryota 1969
172 Ga0495602_0004509 3300048088 Eukaryota 14525
173 Ga0495602_0007331 3300048088 Eukaryota 11548
174 Ga0495602_0011446 3300048088 Eukaryota 9174
175 Ga0495602_0023093 3300048088 Eukaryota 6069
176 Ga0495614_0036056 3300048089 Eukaryota 2124
177 Ga0496118_0098329 3300048921 Bacteria 1988
178 Ga0496119_0177149 3300048922 Bacteria 1121
179 Ga0496120_0004030 3300048923 Eukaryota 12736
180 Ga0496125_0055856 3300048928 Bacteria 3212
181 nmdc:mga05p37_282960_c1 3300050507 Bacteria 1977
182 nmdc:mga08y16_237974_c1 3300050511 Bacteria 1882
183 nmdc:mga0n895_211656_c1 3300050512 Bacteria 1969
184 nmdc:mga0n895_560903_c1 3300050512 Bacteria 1147
185 Ga0500593_000020 3300053117 Bacteria 54324
186 Ga0500616_0001918 3300053153 Bacteria 18574
187 2644002128 2643221598 Bacteria 4578346
188 2644085538 2643221614 Bacteria 4260023
189 2644343090 2643221661 Bacteria 4267604
190 2644366390 2643221666 Bacteria 4265935
191 2883823276 2883821847 Bacteria 5121194
192 Ga0105248_10022798
193 Ga0032354_1033400
194 Ga0055528_1003024
195 Ga0055531_10045198
196 Ga0070666_10001194
197 Ga0068868_100133970
198 Ga0070668_100095729
199 Ga0070674_100117921
200 Ga0070667_100016368
201 Ga0070708_100111817
202 Ga0070678_100130657
203 Ga0070662_100040723
204 Ga0068867_100090081
205 Ga0070698_100124386
206 Ga0070679_100118613
207 Ga0070693_100046813
208 Ga0070665_100054985
209 Ga0068855_100024817
210 Ga0068861_100038071
211 Ga0068863_100093479
212 Ga0068858_100004340
213 Ga0068858_100333482
214 Ga0068860_100150074
215 Ga0081455_10000563
216 Ga0070715_10049060
217 Ga0070716_100018037
218 Ga0068871_100092469
219 Ga0114129_10166789
220 Ga0105243_10120516
221 Ga0105241_10028205
222 Ga0105242_10099139
223 Ga0105238_10059274
224 Ga0105249_10059179
225 Ga0105239_10150844
226 Ga0157373_10000586
227 Ga0157369_10092442
228 Ga0157374_10061233
229 Ga0157374_10559530
230 Ga0163162_10032128
231 Ga0157375_10159196
232 Ga0157380_10023129
233 Ga0157379_10000600
234 Ga0163161_10034512
235 Ga0197907_11278329
236 Ga0206356_10671048
237 Ga0206350_10000923
238 Ga0206354_10703792
239 Ga0206354_11523524
240 Ga0206353_10972529
241 Ga0206353_11371763
242 Ga0213876_10053380
243 Ga0213875_10011319
244 Ga0209673_1001688
245 Ga0209257_1000561
246 Ga0207653_10054410
247 Ga0207680_10002048
248 Ga0207671_10089215
249 Ga0207646_10010524
250 Ga0207706_10045300
251 Ga0207709_10089118
252 Ga0207669_10068455
253 Ga0207665_10012025
254 Ga0207691_10367814
255 Ga0207667_10098202
256 Ga0207712_10045577
257 Ga0207658_10056846
258 Ga0207677_10160641
259 Ga0207703_10002997
260 Ga0207648_10138929
261 Ga0207675_100068709
262 Ga0207675_100073621
263 Ga0268264_10274009
264 Ga0265338_10020496
265 Ga0265325_10001517
266 Ga0265325_10001760
267 Ga0265339_10001275
268 Ga0265327_10001063
269 Ga0265316_10005230
270 Ga0265316_10013722
271 Ga0307408_100240542
272 Ga0265313_10003340
273 Ga0265313_10004491
274 Ga0307514_10036668
275 Ga0307516_10000004
276 Ga0307405_10158078
277 Ga0307410_10138658
278 Ga0307406_10089023
279 Ga0307407_10042716
280 Ga0307407_10109882
281 Ga0307407_10290941
282 Ga0307409_100041671
283 Ga0307409_100045574
284 Ga0307409_100073694
285 Ga0307409_100106339
286 Ga0307416_100074412
287 Ga0307416_100107397
288 Ga0307414_10084377
289 Ga0373955_0156422
290 Ga0373937_0212846
291 Ga0436364_0751994
292 Ga0395901_0298100
293 Ga0436365_1267898
294 Ga0466966_0027882
295 Ga0466961_0100013
296 Ga0466961_0100680
297 Ga0466961_0188977
298 Ga0466963_0094467
299 Ga0466964_0037198
300 Ga0466957_0032615
301 Ga0466957_0036846
302 Ga0466960_0015540
303 Ga0466960_0048551
304 Ga0466959_0098374
305 Ga0466958_0065611
306 Ga0466967_0056536
307 Ga0466967_0058091
308 Ga0466967_0443582
309 Ga0495592_0070887
310 Ga0495592_0181877
311 Ga0495629_0031844
312 Ga0495641_0001476
313 Ga0495641_0010466
314 Ga0495651_0033448
315 Ga0495653_0090330
316 Ga0495606_0027569
317 Ga0495606_0028490
318 Ga0495608_0000917
319 Ga0495608_0053172
320 Ga0495608_0136470
321 Ga0495618_0002769
322 Ga0495618_0008081
323 Ga0495620_0003354
324 Ga0495620_0009896
325 Ga0495628_0000449
326 Ga0495628_0032600
327 Ga0495630_0045643
328 Ga0495630_0072867
329 Ga0495652_0000633
330 Ga0495652_0004432
331 Ga0495652_0008934
332 Ga0495587_0081998
333 Ga0495645_0022330
334 Ga0495645_0040594
335 Ga0495634_0042800
336 Ga0495634_0142511
337 Ga0495635_0021623
338 Ga0495635_0032114
339 Ga0495661_0019565
340 Ga0495657_0011975
341 Ga0495657_0018830
342 Ga0495623_0017069
343 Ga0495623_0095853
344 Ga0495646_0001366
345 Ga0495646_0120945
346 Ga0495669_0000927
347 Ga0495624_0001729
348 Ga0495624_0008553
349 Ga0495600_0058364
350 Ga0495600_0074431
351 Ga0495600_0179562
352 Ga0495604_0007145
353 Ga0495674_0006666
354 Ga0495676_0000519
355 Ga0495676_0003631
356 Ga0495676_0009449
357 Ga0495676_0073773
358 Ga0495676_0260549
359 Ga0495680_0058043
360 Ga0495680_0112271
361 Ga0495677_0027230
362 Ga0495593_0061209
363 Ga0495602_0004509
364 Ga0495602_0007331
365 Ga0495602_0011446
366 Ga0495602_0023093
367 Ga0495614_0036056
368 Ga0496118_0098329
369 Ga0496119_0177149
370 Ga0496120_0004030
371 Ga0496125_0055856
372 nmdc:mga05p37_282960_c1
373 nmdc:mga08y16_237974_c1
374 nmdc:mga0n895_211656_c1
375 nmdc:mga0n895_560903_c1
376 Ga0500593_000020
377 Ga0500616_0001918
378 2644002128
379 2644085538
380 2644343090
381 2644366390
382 2883823276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

30

113

0.97

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

108

165

0.91

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

210

348

0.86

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

242

383

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9673 117 334
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9668 8 338
4b7x-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9653 9 338
4b7x-assembly5.cif.gz_J crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9643 10 338
4b7x-assembly1.cif.gz_H crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9642 8 338
ID Description Score Start End Superfamily
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9675 9 116 3.90.180.10
af_Q9C0Y6_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 137 307 3.40.50.720
af_Q2QVJ8_160_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9657 155 332 3.40.50.720
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 131 306 3.40.50.720
af_Q9C0Y6_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 137 307 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A251XHL8-F1-model_v4 Putative NADP-dependent oxidoreductase YfmJ 0.9836 122 337 GO:0016628
AF-A0A2E8I468-F1-model_v4 deleted 0.9816 8 338
AF-A0A6B3GS61-F1-model_v4 NADP-dependent oxidoreductase 0.9809 91 191 GO:0016628
AF-A0A3D2GQ20-F1-model_v4 NADP-dependent oxidoreductase 0.9771 44 338 GO:0016628
AF-A0A2R5FXQ3-F1-model_v4 Alcohol dehydrogenase 0.9761 77 338 GO:0016628

Map