F293091

General Info

Members Datasets Scaffolds Average Seq Length
190 161 98 377

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0028577|Ga0496122_0028577_2112_3365
Length 417
Sequence MSPADTYVVEKPFHIFAIKGEITMQVQARLLLEDGTLFTGKAFGATGESTGEVVFNTGITGYQEVLSDPSYCGQIVTMTYPLIGNYGIIRDDFESMRPFIHGFVVRHHEETPSNWRAQFTLDTLLKDYEITGISGIDTRMLTRILRHHGTMKGLLTTSNAPLEELKERLGVAQLLRDQVDRVSTKSVFGCPGTKERIVVVDYGSKSGIIRELSNRGADVVVVPHTATAEQIRKLCADGVLLSNGPGDPKDVPHAAKTIASLLGELPIFGICLGHQLLALASGADTEKLKFGHRGGNHPVKELASGRCYITSQNHGYTVKEESVEGTGLIVTHINNNDKTIEGLKHTQYPAFSVQYHPEAAPGPFDSSYLFDEFLEMIRDFKAAKPYVPQQAAMVAASALKQKEEASEVKGDLQYAQK

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
4 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
5 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
8 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
9 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
10 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
11 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
12 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
13 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
14 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
15 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2671180694 Paenibacillus sp. A3 Isolate Unclassified
18 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
19 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
20 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
21 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
22 2738543010 Bacillus sp. YR335 Isolate Unclassified
23 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
24 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
25 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
26 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
27 2818991459 Paenibacillus sp. 597 Isolate Unclassified
28 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
29 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
30 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
31 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
32 2857472729 Cohnella sp. R-74144 Isolate Unclassified
33 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
34 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
35 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
36 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
37 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
38 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
39 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
40 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
41 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
42 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
43 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
44 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
45 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
46 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
47 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
48 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
49 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
50 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
51 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
52 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
53 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
54 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
55 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
56 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
57 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
58 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
59 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
60 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
61 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
62 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
63 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
64 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
65 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
66 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
67 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
68 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
69 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
70 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
71 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
72 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
73 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
74 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
75 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
76 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
77 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
78 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
79 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
80 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
81 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
82 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
83 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
86 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
87 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
155 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
156 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
157 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
158 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
159 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
160 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
161 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 47.89
Metatranscriptomes 3.68
Isolates 48.42

Biome Distribution

Category Percentage (%)
Aerial Root 1.05
Bulb 0
Endosphere 4.74
Nodule 1.05
Rhizoplane 0.53
Rhizosphere 56.32
Stem 0
Stem Tuber 0
Unclassified 36.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1020953 3300003578 Bacteria 6019
2 Ga0055538_1000554 3300003751 Bacteria 12905
3 Ga0055532_1001894 3300003758 Bacteria 5039
4 Ga0055541_1004675 3300003841 Bacteria 2465
5 Ga0070706_100082867 3300005467 Bacteria 2971
6 Ga0075428_100022262 3300006844 Bacteria 7017
7 Ga0075433_10339154 3300006852 Bacteria 1328
8 Ga0075435_100023351 3300007076 Bacteria 4782
9 Ga0075435_100106119 3300007076 Bacteria 2332
10 Ga0105244_10003880 3300009036 Bacteria 10515
11 Ga0105244_10017263 3300009036 Bacteria 4083
12 Ga0105244_10062261 3300009036 Bacteria 1876
13 Ga0111539_10028174 3300009094 Bacteria 6857
14 Ga0111539_10033414 3300009094 Bacteria 6244
15 Ga0114129_10022985 3300009147 Bacteria 8846
16 Ga0114129_10041725 3300009147 Bacteria 6462
17 Ga0105246_10005222 3300011119 Bacteria 7899
18 Ga0209784_100401 3300025224 Bacteria 19661
19 Ga0209566_100058 3300025225 Bacteria 201317
20 Ga0209566_100393 3300025225 Bacteria 35266
21 Ga0209437_100562 3300025233 Bacteria 24419
22 Ga0209025_1009503 3300025294 Bacteria 6758
23 Ga0207655_1008513 3300025728 Bacteria 6496
24 Ga0207684_10069971 3300025910 Bacteria 2982
25 Ga0207428_10055357 3300027907 Bacteria 3154
26 Ga0265322_10008585 3300028654 Bacteria 2976
27 Ga0265760_10012242 3300031090 Bacteria 2452
28 Ga0265332_10013184 3300031238 Bacteria 3664
29 Ga0265339_10025743 3300031249 Bacteria 3373
30 Ga0265316_10007970 3300031344 Bacteria 9902
31 Ga0265342_10000009 3300031712 Bacteria 220210
32 Ga0373926_0001577 3300035083 Bacteria 7006
33 Ga0316574_0013840 3300035398 Bacteria 4648
34 Ga0373935_0004520 3300035692 Bacteria 8178
35 Ga0373927_0226282 3300035695 Bacteria 1229
36 Ga0373947_0000002 3300035725 Bacteria 383924
37 Ga0439449_0000098 3300042007 Bacteria 27750
38 Ga0439462_0001463 3300042015 Bacteria 5269
39 Ga0466969_0005687 3300044656 Bacteria 6628
40 Ga0466966_0065887 3300044684 Bacteria 2277
41 Ga0453684_0026991 3300044712 Bacteria 8264
42 Ga0453684_0081289 3300044712 Unclassified 4042
43 Ga0466959_0002253 3300045049 Bacteria 12292
44 Ga0496116_0005391 3300048919 Bacteria 11898
45 Ga0496116_0019626 3300048919 Bacteria 5170
46 Ga0496116_0037590 3300048919 Bacteria 3373
47 Ga0496116_0063906 3300048919 Bacteria 2368
48 Ga0496116_0070020 3300048919 Bacteria 2228
49 Ga0496116_0108567 3300048919 Bacteria 1638
50 Ga0496116_0145202 3300048919 Bacteria 1327
51 Ga0496117_0011509 3300048920 Bacteria 7919
52 Ga0496117_0018307 3300048920 Bacteria 5808
53 Ga0496118_0122378 3300048921 Bacteria 1692
54 Ga0496119_0004374 3300048922 Bacteria 14102
55 Ga0496119_0004929 3300048922 Bacteria 13050
56 Ga0496120_0000215 3300048923 Bacteria 99455
57 Ga0496120_0016485 3300048923 Bacteria 4830
58 Ga0496122_0002091 3300048925 Bacteria 29584
59 Ga0496122_0028577 3300048925 Bacteria 4726
60 Ga0496124_0000368 3300048927 Bacteria 82338
61 Ga0496124_0001059 3300048927 Bacteria 43414
62 Ga0496124_0058206 3300048927 Bacteria 3252
63 Ga0496125_0001336 3300048928 Bacteria 36363
64 Ga0496125_0001763 3300048928 Bacteria 30006
65 Ga0496125_0011917 3300048928 Bacteria 8662
66 Ga0496125_0018066 3300048928 Bacteria 6703
67 Ga0496126_0000749 3300048929 Bacteria 58862
68 Ga0496126_0005813 3300048929 Bacteria 13942
69 Ga0496126_0024846 3300048929 Bacteria 5777
70 Ga0496126_0111387 3300048929 Bacteria 2384
71 Ga0501343_002088 3300049132 Bacteria 1408
72 Ga0501305_001159 3300049161 Bacteria 2490
73 Ga0501312_000098 3300049528 Bacteria 5197
74 Ga0501315_005540 3300049531 Bacteria 1370
75 Ga0501320_002074 3300049536 Bacteria 1568
76 Ga0501038_0032979 3300049574 Bacteria 4562
77 Ga0501040_0191326 3300049576 Bacteria 1452
78 Ga0501043_0101126 3300049579 Bacteria 2266
79 Ga0501047_0036835 3300049581 Bacteria 4728
80 Ga0501067_0001167 3300049583 Bacteria 14265
81 Ga0501068_0001397 3300049584 Bacteria 12832
82 Ga0501069_0010369 3300049585 Bacteria 4930
83 Ga0501072_0000029 3300049588 Bacteria 134083
84 Ga0501074_0011174 3300049590 Bacteria 6521
85 Ga0501074_0028081 3300049590 Bacteria 4078
86 Ga0501077_0050295 3300049593 Bacteria 2649
87 Ga0501079_0001287 3300049741 Bacteria 17642
88 Ga0501083_0015438 3300049744 Bacteria 5349
89 Ga0501044_0143761 3300049823 Bacteria 2372
90 nmdc:mga05p37_32409_c1 3300050507 Bacteria 6389
91 nmdc:mga08y16_19800_c1 3300050511 Bacteria 6120
92 nmdc:mga08y16_50718_c1 3300050511 Bacteria 4343
93 nmdc:mga0rr50_17737_c1 3300050513 Bacteria 4761
94 nmdc:mga0rr50_55193_c1 3300050513 Bacteria 2963
95 Ga0500594_0008949 3300053118 Bacteria 2294
96 Ga0501084_0000018 3300054114 Bacteria 147013
97 Ga0501082_0000287 3300060353 Bacteria 44479
98 Ga0530510_0099837 3300061734 Bacteria 2122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0063906 Ga0496116_0063906_1306_2295 324
2 3300048928 Ga0496125_0011917 Ga0496125_0011917_6291_7355 328
3 3300028654 Ga0265322_10008585 Ga0265322_100085852 351
4 3300031238 Ga0265332_10013184 Ga0265332_100131842 351
5 3300031249 Ga0265339_10025743 Ga0265339_100257432 351
6 3300031344 Ga0265316_10007970 Ga0265316_1000797010 351
7 3300031712 Ga0265342_10000009 Ga0265342_1000000966 351
8 3300044712 Ga0453684_0081289 Ga0453684_0081289_2374_3477 351
9 3300049590 Ga0501074_0028081 Ga0501074_0028081_2029_3141 352
10 3300049593 Ga0501077_0050295 Ga0501077_0050295_22_1140 352
11 3300035083 Ga0373926_0001577 Ga0373926_0001577_1426_2520 353
12 3300035692 Ga0373935_0004520 Ga0373935_0004520_2645_3739 353
13 3300035725 Ga0373947_0000002 Ga0373947_0000002_290598_291692 353
14 3300048928 Ga0496125_0018066 Ga0496125_0018066_3119_4183 354
15 3300048929 Ga0496126_0111387 Ga0496126_0111387_28_1092 354
16 3300049576 Ga0501040_0191326 Ga0501040_0191326_27_1100 354
17 3300007076 Ga0075435_100023351 Ga0075435_1000233513 356
18 3300009094 Ga0111539_10028174 Ga0111539_100281742 356
19 3300035398 Ga0316574_0013840 Ga0316574_0013840_1807_2919 356
20 3300050511 nmdc:mga08y16_19800_c1 nmdc:mga08y16_19800_c1_2450_3571 356
21 3300050513 nmdc:mga0rr50_17737_c1 nmdc:mga0rr50_17737_c1_1413_2534 356
22 3300049574 Ga0501038_0032979 Ga0501038_0032979_2193_3326 357
23 3300049579 Ga0501043_0101126 Ga0501043_0101126_54_1187 357
24 3300049581 Ga0501047_0036835 Ga0501047_0036835_1731_2864 357
25 3300049583 Ga0501067_0001167 Ga0501067_0001167_7601_8734 357
26 3300049584 Ga0501068_0001397 Ga0501068_0001397_5118_6251 357
27 3300049585 Ga0501069_0010369 Ga0501069_0010369_3713_4846 357
28 3300049588 Ga0501072_0000029 Ga0501072_0000029_100375_101508 357
29 3300049590 Ga0501074_0011174 Ga0501074_0011174_167_1300 357
30 3300049741 Ga0501079_0001287 Ga0501079_0001287_12217_13350 357
31 3300049744 Ga0501083_0015438 Ga0501083_0015438_2916_4049 357
32 3300049823 Ga0501044_0143761 Ga0501044_0143761_314_1447 357
33 3300054114 Ga0501084_0000018 Ga0501084_0000018_45509_46642 357
34 3300060353 Ga0501082_0000287 Ga0501082_0000287_31319_32452 357
35 3300061734 Ga0530510_0099837 Ga0530510_0099837_259_1392 357
36 iso_pu_bacteria 2738543010 2739231329 357
37 3300044712 Ga0453684_0026991 Ga0453684_0026991_2904_3986 358
38 iso_pu_bacteria 2936361878 2936365208 358
39 3300053118 Ga0500594_0008949 Ga0500594_0008949_941_2068 359
40 iso_pu_bacteria 2711768088 2712199535 359
41 iso_pu_bacteria 2977254563 2977258374 359
42 iso_pu_bacteria 2990275345 2990279408 359
43 3300005467 Ga0070706_100082867 Ga0070706_1000828672 360
44 3300009147 Ga0114129_10022985 Ga0114129_100229854 360
45 3300025910 Ga0207684_10069971 Ga0207684_100699712 360
46 iso_pu_bacteria 2816332295 2817479812 360
47 iso_pu_bacteria 3006858327 3006860150 360
48 3300007076 Ga0075435_100106119 Ga0075435_1001061193 361
49 3300049132 Ga0501343_002088 Ga0501343_002088_58_1143 361
50 3300049161 Ga0501305_001159 Ga0501305_001159_1122_2207 361
51 3300049528 Ga0501312_000098 Ga0501312_000098_2206_3291 361
52 3300049531 Ga0501315_005540 Ga0501315_005540_256_1341 361
53 3300049536 Ga0501320_002074 Ga0501320_002074_256_1341 361
54 3300050513 nmdc:mga0rr50_55193_c1 nmdc:mga0rr50_55193_c1_376_1518 361
55 iso_pu_bacteria 2510917027 2511179208 361
56 iso_pu_bacteria 2512564013 2512640886 361
57 iso_pu_bacteria 2857460504 2857462151 361
58 iso_pu_bacteria 2857465823 2857471635 361
59 iso_pu_bacteria 2857591370 2857593054 361
60 iso_pu_bacteria 2915597211 2915602376 361
61 iso_pu_bacteria 2915606848 2915612204 361
62 iso_pu_bacteria 2929183550 2929187556 361
63 3300006844 Ga0075428_100022262 Ga0075428_1000222625 363
64 3300006852 Ga0075433_10339154 Ga0075433_103391541 363
65 3300009094 Ga0111539_10033414 Ga0111539_100334144 363
66 3300009147 Ga0114129_10041725 Ga0114129_100417254 363
67 3300027907 Ga0207428_10055357 Ga0207428_100553571 363
68 3300031090 Ga0265760_10012242 Ga0265760_100122422 363
69 3300050507 nmdc:mga05p37_32409_c1 nmdc:mga05p37_32409_c1_3496_4665 363
70 3300050511 nmdc:mga08y16_50718_c1 nmdc:mga08y16_50718_c1_1893_3062 363
71 3300048919 Ga0496116_0005391 Ga0496116_0005391_9581_10717 364
72 3300048920 Ga0496117_0018307 Ga0496117_0018307_4419_5555 364
73 3300048922 Ga0496119_0004929 Ga0496119_0004929_2898_4034 364
74 3300048923 Ga0496120_0000215 Ga0496120_0000215_29924_31060 364
75 3300048927 Ga0496124_0000368 Ga0496124_0000368_62421_63557 364
76 3300048929 Ga0496126_0000749 Ga0496126_0000749_3364_4500 364
77 3300048929 Ga0496126_0005813 Ga0496126_0005813_9503_10639 364
78 3300003758 Ga0055532_1001894 Ga0055532_10018942 365
79 3300009036 Ga0105244_10017263 Ga0105244_100172632 365
80 3300035695 Ga0373927_0226282 Ga0373927_0226282_80_1177 365
81 iso_pu_bacteria 2956897341 2956901403 365
82 iso_pu_bacteria 2512564039 2512734858 372
83 iso_pu_bacteria 2524023129 2524186546 372
84 iso_pu_bacteria 2563366752 2563927013 372
85 iso_pu_bacteria 2585428059 2587737850 372
86 iso_pu_bacteria 2593339198 2595316504 372
87 iso_pu_bacteria 2643221676 2644423063 372
88 iso_pu_bacteria 2671180694 2673821814 372
89 iso_pu_bacteria 2791355222 2793184648 372
90 iso_pu_bacteria 2818991459 2819670490 372
91 iso_pu_bacteria 2857453340 2857459406 372
92 iso_pu_bacteria 2857472729 2857473507 372
93 iso_pu_bacteria 2864997549 2864999908 372
94 iso_pu_bacteria 2865002811 2865003495 372
95 iso_pu_bacteria 2888578766 2888580978 372
96 iso_pu_bacteria 2889049205 2889050339 372
97 iso_pu_bacteria 2889295896 2889296170 372
98 iso_pu_bacteria 2904113452 2904114805 372
99 iso_pu_bacteria 2904755435 2904760141 372
100 iso_pu_bacteria 2907202186 2907205746 372
101 iso_pu_bacteria 2919425241 2919427205 372
102 iso_pu_bacteria 2925326138 2925326930 372
103 iso_pu_bacteria 2971410472 2971417251 372
104 iso_pu_bacteria 2980125574 2980125775 372
105 iso_pu_bacteria 2980182181 2980184461 372
106 iso_pu_bacteria 2981284811 2981287913 372
107 iso_pu_bacteria 2981289755 2981292374 372
108 iso_pu_bacteria 2981980479 2981983532 372
109 iso_pu_bacteria 2981985349 2981988430 372
110 iso_pu_bacteria 2984527788 2984530321 372
111 iso_pu_bacteria 2984532647 2984536429 372
112 iso_pu_bacteria 8054795415 8054798092 372
113 iso_pu_bacteria 8055632911 8055635098 372
114 iso_pu_bacteria 8056533031 8056539959 372
115 iso_pu_bacteria 8057473075 8057473785 372
116 iso_pu_bacteria 8057473075 8057476235 372
117 iso_pu_bacteria 8057733483 8057737648 372
118 iso_pu_bacteria 8057977335 8057979080 372
119 iso_pu_bacteria 2548877040 2550906273 374
120 iso_pu_bacteria 2571042143 2571532084 374
121 iso_pu_bacteria 2571042588 2573037530 374
122 iso_pu_bacteria 2576861424 2578337979 374
123 iso_pu_bacteria 2579778775 2580933084 374
124 iso_pu_bacteria 2600255286 2601639085 374
125 iso_pu_bacteria 2619619294 2621276351 374
126 iso_pu_bacteria 2721755693 2723604954 374
127 iso_pu_bacteria 2728368933 2728534266 374
128 iso_pu_bacteria 2728369359 2730135597 374
129 iso_pu_bacteria 2751185905 2753811000 374
130 iso_pu_bacteria 2802428803 2802437267 374
131 iso_pu_bacteria 2881636855 2881640903 374
132 iso_pu_bacteria 2889276214 2889280865 374
133 iso_pu_bacteria 2904595352 2904598356 374
134 iso_pu_bacteria 2929206907 2929210552 374
135 iso_pu_bacteria 2938649242 2938650163 374
136 iso_pu_bacteria 2939702853 2939704611 374
137 iso_pu_bacteria 2968558590 2968564022 374
138 iso_pu_bacteria 2971403814 2971407207 374
139 iso_pu_bacteria 2971511577 2971512577 374
140 iso_pu_bacteria 2980176882 2980178226 374
141 iso_pu_bacteria 2988225383 2988228571 374
142 iso_pu_bacteria 2996632988 2996635953 374
143 iso_pu_bacteria 2996706504 2996708128 374
144 iso_pu_bacteria 648028048 648171022 374
145 iso_pu_bacteria 8054465665 8054470181 374
146 iso_pu_bacteria 2643221543 2643738051 375
147 3300003841 Ga0055541_1004675 Ga0055541_10046752 376
148 3300025225 Ga0209566_100058 Ga0209566_100058146 376
149 3300025225 Ga0209566_100393 Ga0209566_10039311 376
150 3300025294 Ga0209025_1009503 Ga0209025_10095033 376
151 3300042007 Ga0439449_0000098 Ga0439449_0000098_14683_15828 376
152 3300042015 Ga0439462_0001463 Ga0439462_0001463_1153_2298 376
153 3300044656 Ga0466969_0005687 Ga0466969_0005687_5070_6254 376
154 3300044684 Ga0466966_0065887 Ga0466966_0065887_676_1860 376
155 3300045049 Ga0466959_0002253 Ga0466959_0002253_6613_7797 376
156 3300048919 Ga0496116_0019626 Ga0496116_0019626_64_1209 376
157 3300048919 Ga0496116_0070020 Ga0496116_0070020_193_1338 376
158 3300048919 Ga0496116_0145202 Ga0496116_0145202_38_1225 376
159 3300048925 Ga0496122_0002091 Ga0496122_0002091_24029_25222 376
160 3300048925 Ga0496122_0028577 Ga0496122_0028577_2112_3365 376
161 3300048927 Ga0496124_0001059 Ga0496124_0001059_7263_8432 376
162 3300048927 Ga0496124_0058206 Ga0496124_0058206_462_1607 376
163 3300048928 Ga0496125_0001336 Ga0496125_0001336_7540_8709 376
164 iso_pu_bacteria 2821111986 2821114650 376
165 iso_pu_bacteria 2864733723 2864735409 376
166 iso_pu_bacteria 2885526491 2885527992 376
167 iso_pu_bacteria 2889042446 2889046808 376
168 iso_pu_bacteria 2904162308 2904163219 376
169 iso_pu_bacteria 2904490793 2904493714 376
170 iso_pu_bacteria 2919160200 2919162794 376
171 iso_pu_bacteria 2931384279 2931390256 376
172 iso_pu_bacteria 2939679117 2939679724 376
173 iso_pu_bacteria 2945991243 2945997519 376
174 iso_pu_bacteria 2946053406 2946053730 376
175 3300003578 Ga0006562J51391_1020953 Ga0006562J51391_10209532 378
176 3300003751 Ga0055538_1000554 Ga0055538_10005544 378
177 3300009036 Ga0105244_10003880 Ga0105244_100038805 378
178 3300009036 Ga0105244_10062261 Ga0105244_100622612 378
179 3300011119 Ga0105246_10005222 Ga0105246_100052222 378
180 3300025224 Ga0209784_100401 Ga0209784_10040112 378
181 3300025233 Ga0209437_100562 Ga0209437_10056216 378
182 3300025728 Ga0207655_1008513 Ga0207655_10085133 378
183 3300048919 Ga0496116_0037590 Ga0496116_0037590_336_1472 378
184 3300048919 Ga0496116_0108567 Ga0496116_0108567_29_1258 378
185 3300048920 Ga0496117_0011509 Ga0496117_0011509_5704_6840 378
186 3300048921 Ga0496118_0122378 Ga0496118_0122378_520_1656 378
187 3300048922 Ga0496119_0004374 Ga0496119_0004374_7364_8500 378
188 3300048923 Ga0496120_0016485 Ga0496120_0016485_2032_3168 378
189 3300048928 Ga0496125_0001763 Ga0496125_0001763_20313_21449 378
190 3300048929 Ga0496126_0024846 Ga0496126_0024846_2850_3986 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

30

155

0.99

PF00117

GATase

Glutamine amidotransferase class-I

198

376

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.9514 2 360
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9461 2 359
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.9438 2 359
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9413 2 359
1t36-assembly1.cif.gz_B crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate 0.9378 2 359
ID Description Score Start End Superfamily
af_Q2FZ73_174_352_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9788 175 351 3.40.50.880
af_Q58425_140_353_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9676 156 355 3.40.50.880
af_Q2FZ73_174_352_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9627 175 351 3.40.50.880
af_P9WPK5_1_155_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9536 2 148 3.50.30.20
af_C6TIQ8_51_199_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9511 3 148 3.50.30.20
ID Description Score Start End GO Terms
AF-A0A2S8K3P7-F1-model_v4 deleted 0.9937 194 301
AF-A0A2N8GFJ5-F1-model_v4 deleted 0.9932 240 318
AF-X1QMB8-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9925 199 301 GO:0005524
GO:0016874
AF-A0A7Z9XQK1-F1-model_v4 carbamoyl-phosphate synthase (ammonia) (EC 6.3.4.16) 0.9838 173 330 GO:0004088
GO:0005524
GO:0005737
GO:0006221
GO:0006541
GO:0046872
AF-A0A1B8UPQ8-F1-model_v4 Carbamoyl phosphate synthase small chain (EC 6.3.5.5) (Carbamoyl phosphate synthetase glutamine chain) 0.9814 1 378 GO:0004088
GO:0004359
GO:0005524
GO:0006207
GO:0006526
GO:0006541
GO:0044205

Feature Viewer

pLDDT pTM Quality
90.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map