F293021

General Info

Members Datasets Scaffolds Average Seq Length
190 154 183 144

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0001966|Ga0495625_0001966_15666_16178
Length 170
Sequence VASNEETIQGEEHRRALTHRTLPMAIRHMDDPHDLQRFLNAQQGVHDTALAELRRGRKTTHWMWFVFPQVAGLGLSDMSRRYAIASRAEARAYLDHPVLGARLVKGVAAVNAVQGRTAHEIFGSPDDRKFQSCLTLFEQVASAPEVFAAALDRHYGGERDARTLQALERA

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
90 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
93 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
154 8005258706 Rhizobium sp. R693 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 0
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 1.58
Rhizoplane 2.11
Rhizosphere 74.74
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000364 3300002705 Bacteria 29276
2 JGI25157J39369_1000018 3300002741 Bacteria 177410
3 JGI25164J39214_1006506 3300002772 Bacteria 1223
4 Ga0055539_1000909 3300003752 Bacteria 6686
5 Ga0055526_1063845 3300003771 Bacteria 773
6 Ga0065165_1034659 3300005262 Unclassified 1559
7 Ga0070658_10477758 3300005327 Bacteria 1075
8 Ga0070658_10582997 3300005327 Bacteria 969
9 Ga0070670_100217502 3300005331 Bacteria 1662
10 Ga0070666_10792750 3300005335 Bacteria 697
11 Ga0070682_101505977 3300005337 Bacteria 579
12 Ga0070660_100117670 3300005339 Bacteria 2119
13 Ga0070661_101270517 3300005344 Bacteria 617
14 Ga0070667_101038683 3300005367 Bacteria 765
15 Ga0070663_100326903 3300005455 Bacteria 1235
16 Ga0070684_100178430 3300005535 Bacteria 1931
17 Ga0068853_100040579 3300005539 Bacteria 3971
18 Ga0070665_100031526 3300005548 Bacteria 5335
19 Ga0070665_100198413 3300005548 Bacteria 2007
20 Ga0068855_100079629 3300005563 Bacteria 3799
21 Ga0068855_100334569 3300005563 Bacteria 1671
22 Ga0070664_100118800 3300005564 Unclassified 2313
23 Ga0068857_100007724 3300005577 Bacteria 9267
24 Ga0068854_100063830 3300005578 Bacteria 2674
25 Ga0068854_102122433 3300005578 Bacteria 519
26 Ga0068856_100015909 3300005614 Bacteria 7272
27 Ga0068856_100122928 3300005614 Bacteria 2598
28 Ga0068856_100903610 3300005614 Bacteria 902
29 Ga0068852_100768529 3300005616 Unclassified 976
30 Ga0068863_100823118 3300005841 Bacteria 926
31 Ga0068863_101476174 3300005841 Bacteria 688
32 Ga0068858_100000408 3300005842 Bacteria 44660
33 Ga0075364_10407228 3300006051 Unclassified 928
34 Ga0068871_100371545 3300006358 Bacteria 1268
35 Ga0075433_10556462 3300006852 Bacteria 1008
36 Ga0075434_100982710 3300006871 Bacteria 858
37 Ga0099794_10105383 3300007265 Bacteria 1410
38 Ga0105240_10093540 3300009093 Bacteria 3668
39 Ga0105241_10785292 3300009174 Bacteria 876
40 Ga0105241_11303784 3300009174 Bacteria 692
41 Ga0105248_10457306 3300009177 Bacteria 1439
42 Ga0105237_10526982 3300009545 Bacteria 1188
43 Ga0105237_11681305 3300009545 Bacteria 642
44 Ga0105238_10233625 3300009551 Bacteria 1815
45 Ga0105239_10562274 3300010375 Bacteria 1299
46 Ga0105239_10728527 3300010375 Bacteria 1134
47 Ga0105246_11587051 3300011119 Bacteria 618
48 Ga0157373_10176439 3300013100 Bacteria 1504
49 Ga0157369_10027930 3300013105 Bacteria 6249
50 Ga0157374_10860264 3300013296 Unclassified 924
51 Ga0157372_10149842 3300013307 Bacteria 2692
52 Ga0157376_11894757 3300014969 Bacteria 633
53 Ga0182007_10189938 3300015262 Bacteria 714
54 Ga0207427_102840 3300025231 Bacteria 4195
55 Ga0209258_101823 3300025242 Bacteria 6505
56 Ga0209646_1000067 3300025246 Bacteria 241595
57 Ga0209026_1000033 3300025250 Bacteria 318512
58 Ga0209677_100196 3300025253 Bacteria 48682
59 Ga0209677_101156 3300025253 Bacteria 12253
60 Ga0209759_1000024 3300025256 Bacteria 318512
61 Ga0209025_1005648 3300025294 Bacteria 10080
62 Ga0209564_1000290 3300025295 Bacteria 101964
63 Ga0207710_10017202 3300025900 Bacteria 3065
64 Ga0207705_10537825 3300025909 Bacteria 908
65 Ga0207705_10932148 3300025909 Bacteria 672
66 Ga0207654_10195107 3300025911 Bacteria 1330
67 Ga0207695_10018205 3300025913 Bacteria 8129
68 Ga0207657_10008311 3300025919 Bacteria 10562
69 Ga0207657_10078857 3300025919 Bacteria 2772
70 Ga0207652_10335105 3300025921 Bacteria 1366
71 Ga0207652_10637939 3300025921 Bacteria 953
72 Ga0207694_10063893 3300025924 Bacteria 2868
73 Ga0207694_10183289 3300025924 Bacteria 1698
74 Ga0207690_10280484 3300025932 Bacteria 1297
75 Ga0207703_10000171 3300026035 Bacteria 75791
76 Ga0207703_10592473 3300026035 Bacteria 1048
77 Ga0207639_10219429 3300026041 Bacteria 1641
78 Ga0207678_10503110 3300026067 Bacteria 1056
79 Ga0207702_10001078 3300026078 Bacteria 27950
80 Ga0207702_10717665 3300026078 Bacteria 986
81 Ga0207641_10150374 3300026088 Bacteria 2108
82 Ga0207674_10022586 3300026116 Bacteria 6753
83 Ga0207698_10366101 3300026142 Bacteria 1367
84 Ga0207698_10462357 3300026142 Bacteria 1227
85 Ga0268266_10034676 3300028379 Bacteria 4292
86 Ga0307515_10043313 3300028794 Bacteria 7002
87 Ga0307515_10385253 3300028794 Bacteria 1033
88 Ga0316180_1010042 3300030736 Bacteria 925
89 Ga0307408_100457310 3300031548 Bacteria 1109
90 Ga0307508_10305774 3300031616 Bacteria 1183
91 Ga0307407_10000015 3300031903 Bacteria 143258
92 Ga0307416_100000025 3300032002 Bacteria 178154
93 Ga0307414_10013819 3300032004 Bacteria 4818
94 Ga0373934_0186925 3300035086 Bacteria 852
95 Ga0373933_0201655 3300035724 Bacteria 1273
96 Ga0373937_0042803 3300036401 Bacteria 4132
97 Ga0395900_0676625 3300037418 Bacteria 967
98 Ga0395905_0003893 3300037471 Bacteria 15751
99 Ga0395905_0495172 3300037471 Bacteria 1122
100 Ga0395901_0181146 3300038443 Bacteria 2210
101 Ga0436360_1107635 3300039438 Bacteria 3538
102 Ga0436363_0179834 3300039450 Bacteria 613
103 Ga0436363_0544570 3300039450 Bacteria 1619
104 Ga0439438_087691 3300041405 Bacteria 760
105 Ga0451800_0677143 3300041459 Bacteria 708
106 Ga0439437_013277 3300042000 Bacteria 957
107 Ga0439452_082301 3300042010 Bacteria 701
108 Ga0450911_041058 3300042115 Bacteria 601
109 Ga0450920_013668 3300042122 Bacteria 1530
110 Ga0450907_030840 3300042146 Bacteria 911
111 Ga0450909_054482 3300042185 Bacteria 627
112 Ga0439464_0008607 3300042439 Bacteria 2675
113 Ga0439460_0009753 3300042461 Bacteria 2445
114 Ga0439440_0139002 3300042993 Bacteria 688
115 Ga0466972_0035174 3300044658 Bacteria 2452
116 Ga0466965_0038093 3300044683 Bacteria 2361
117 Ga0466966_0187552 3300044684 Bacteria 1254
118 Ga0466960_0110247 3300044901 Bacteria 1429
119 Ga0466959_0010849 3300045049 Bacteria 6532
120 Ga0466958_1001990 3300045836 Bacteria 545
121 Ga0495590_0000573 3300046457 Bacteria 17453
122 Ga0495638_0000317 3300046460 Bacteria 62243
123 Ga0495638_0003909 3300046460 Bacteria 11526
124 Ga0495653_0508652 3300046463 Bacteria 750
125 Ga0495650_0227730 3300046471 Bacteria 640
126 Ga0495608_0057960 3300046511 Bacteria 2554
127 Ga0495610_0015376 3300046512 Bacteria 4451
128 Ga0495631_0009374 3300046518 Bacteria 4891
129 Ga0495597_0204657 3300046542 Bacteria 789
130 Ga0495645_0224710 3300046543 Bacteria 1261
131 Ga0495622_0018748 3300046557 Bacteria 3222
132 Ga0495667_0001239 3300046559 Bacteria 16711
133 Ga0495668_0004222 3300046616 Bacteria 10345
134 Ga0495668_0505202 3300046616 Bacteria 666
135 Ga0495625_0001966 3300046660 Bacteria 23202
136 Ga0495657_0001568 3300046675 Bacteria 19679
137 Ga0495684_0073045 3300047471 Bacteria 2606
138 Ga0495686_0000870 3300047472 Bacteria 38471
139 Ga0495686_0034366 3300047472 Bacteria 3266
140 Ga0495686_0512648 3300047472 Bacteria 630
141 Ga0496106_0003594 3300048909 Bacteria 11557
142 Ga0496107_0000087 3300048910 Bacteria 44221
143 Ga0496109_1640274 3300048912 Bacteria 577
144 Ga0496117_0146006 3300048920 Bacteria 1408
145 Ga0496121_0002352 3300048924 Bacteria 29158
146 Ga0496121_0003749 3300048924 Bacteria 21296
147 Ga0496124_0214516 3300048927 Bacteria 1453
148 Ga0496124_0800274 3300048927 Bacteria 584
149 Ga0496125_0279791 3300048928 Bacteria 1034
150 Ga0496126_0208380 3300048929 Bacteria 1647
151 Ga0496126_0792964 3300048929 Bacteria 727
152 Ga0495678_001114 3300049459 Bacteria 22387
153 Ga0495682_0135759 3300049460 Bacteria 879
154 Ga0501032_0135137 3300049569 Bacteria 1626
155 Ga0501032_0247734 3300049569 Bacteria 1157
156 Ga0501033_0032239 3300049570 Bacteria 3935
157 Ga0501034_0029726 3300049571 Bacteria 5555
158 Ga0501037_0237283 3300049573 Bacteria 1279
159 Ga0501039_0289363 3300049575 Bacteria 1288
160 Ga0501043_0385831 3300049579 Bacteria 1060
161 Ga0501046_0152330 3300049580 Bacteria 1744
162 Ga0501047_0113004 3300049581 Bacteria 2598
163 Ga0501047_0383145 3300049581 Bacteria 1240
164 Ga0501047_0413117 3300049581 Bacteria 1181
165 Ga0501070_0170501 3300049586 Bacteria 1793
166 Ga0501080_1514406 3300049742 Bacteria 570
167 Ga0501035_0003779 3300049822 Bacteria 14432
168 Ga0501035_0151861 3300049822 Bacteria 2009
169 Ga0501035_0224735 3300049822 Bacteria 1602
170 Ga0501044_0019151 3300049823 Bacteria 7327
171 Ga0501044_0074452 3300049823 Bacteria 3450
172 Ga0501044_0276391 3300049823 Bacteria 1614
173 nmdc:mga0n895_383870_c1 3300050512 Bacteria 1421
174 nmdc:mga0a205_241170_c1 3300050515 Bacteria 1688
175 Ga0500578_0000124 3300053086 Bacteria 92437
176 Ga0500566_0108084 3300053094 Bacteria 1516
177 Ga0500562_000984 3300053108 Bacteria 6967
178 Ga0500594_0000130 3300053118 Bacteria 20994
179 Ga0500595_003953 3300053119 Bacteria 6774
180 Ga0500608_034080 3300053122 Bacteria 2425
181 Ga0500618_000195 3300053125 Bacteria 49434
182 Ga0500622_0001273 3300053156 Bacteria 20547
183 Ga0500622_0022082 3300053156 Bacteria 3376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10477758 Ga0070658_104777582 135
2 3300005335 Ga0070666_10792750 Ga0070666_107927501 135
3 3300005344 Ga0070661_101270517 Ga0070661_1012705172 135
4 3300005548 Ga0070665_100198413 Ga0070665_1001984131 135
5 3300006358 Ga0068871_100371545 Ga0068871_1003715452 135
6 3300049581 Ga0501047_0413117 Ga0501047_0413117_562_969 135
7 3300049822 Ga0501035_0003779 Ga0501035_0003779_1579_1986 135
8 3300049823 Ga0501044_0019151 Ga0501044_0019151_4593_5000 135
9 3300053119 Ga0500595_003953 Ga0500595_003953_519_926 135
10 3300009174 Ga0105241_11303784 Ga0105241_113037841 136
11 3300025919 Ga0207657_10008311 Ga0207657_100083116 136
12 3300025921 Ga0207652_10637939 Ga0207652_106379391 136
13 3300031616 Ga0307508_10305774 Ga0307508_103057741 136
14 3300046518 Ga0495631_0009374 Ga0495631_0009374_3729_4139 136
15 3300046557 Ga0495622_0018748 Ga0495622_0018748_491_901 136
16 3300048929 Ga0496126_0208380 Ga0496126_0208380_924_1334 136
17 3300042185 Ga0450909_054482 Ga0450909_054482_102_518 137
18 3300049460 Ga0495682_0135759 Ga0495682_0135759_315_728 137
19 iso_pu_bacteria 2582581279 2585147825 137
20 iso_pu_bacteria 2643221609 2644060255 137
21 iso_pu_bacteria 2643221611 2644076050 137
22 iso_pu_bacteria 643348564 643600382 137
23 3300005262 Ga0065165_1034659 Ga0065165_10346592 138
24 iso_pu_bacteria 2508501123 2509115438 138
25 3300005331 Ga0070670_100217502 Ga0070670_1002175022 139
26 3300005367 Ga0070667_101038683 Ga0070667_1010386832 139
27 3300013100 Ga0157373_10176439 Ga0157373_101764392 139
28 3300037418 Ga0395900_0676625 Ga0395900_0676625_245_670 139
29 3300037471 Ga0395905_0003893 Ga0395905_0003893_9746_10171 139
30 3300037471 Ga0395905_0495172 Ga0395905_0495172_289_714 139
31 3300038443 Ga0395901_0181146 Ga0395901_0181146_1669_2094 139
32 3300039450 Ga0436363_0179834 Ga0436363_0179834_119_559 139
33 3300039450 Ga0436363_0544570 Ga0436363_0544570_1102_1542 139
34 3300044684 Ga0466966_0187552 Ga0466966_0187552_711_1151 139
35 3300045836 Ga0466958_1001990 Ga0466958_1001990_61_501 139
36 3300048924 Ga0496121_0002352 Ga0496121_0002352_5065_5496 139
37 3300049569 Ga0501032_0247734 Ga0501032_0247734_157_585 139
38 3300049570 Ga0501033_0032239 Ga0501033_0032239_1477_1905 139
39 3300049571 Ga0501034_0029726 Ga0501034_0029726_1331_1759 139
40 3300049573 Ga0501037_0237283 Ga0501037_0237283_525_953 139
41 3300049575 Ga0501039_0289363 Ga0501039_0289363_805_1233 139
42 3300049579 Ga0501043_0385831 Ga0501043_0385831_561_989 139
43 3300049581 Ga0501047_0113004 Ga0501047_0113004_1666_2094 139
44 3300049742 Ga0501080_1514406 Ga0501080_1514406_132_560 139
45 3300049822 Ga0501035_0151861 Ga0501035_0151861_893_1321 139
46 3300049823 Ga0501044_0074452 Ga0501044_0074452_1966_2394 139
47 iso_pu_bacteria 2842775625 2842780066 139
48 3300005616 Ga0068852_100768529 Ga0068852_1007685292 140
49 3300005841 Ga0068863_100823118 Ga0068863_1008231182 140
50 3300014969 Ga0157376_11894757 Ga0157376_118947571 140
51 3300026088 Ga0207641_10150374 Ga0207641_101503743 140
52 3300026142 Ga0207698_10366101 Ga0207698_103661012 140
53 3300031903 Ga0307407_10000015 Ga0307407_1000001519 140
54 3300032002 Ga0307416_100000025 Ga0307416_10000002519 140
55 3300032004 Ga0307414_10013819 Ga0307414_100138192 140
56 3300042000 Ga0439437_013277 Ga0439437_013277_331_756 140
57 3300042439 Ga0439464_0008607 Ga0439464_0008607_1036_1461 140
58 3300042461 Ga0439460_0009753 Ga0439460_0009753_632_1057 140
59 3300042993 Ga0439440_0139002 Ga0439440_0139002_201_626 140
60 3300046457 Ga0495590_0000573 Ga0495590_0000573_13692_14114 140
61 3300046460 Ga0495638_0003909 Ga0495638_0003909_8567_8989 140
62 3300046471 Ga0495650_0227730 Ga0495650_0227730_115_537 140
63 3300046512 Ga0495610_0015376 Ga0495610_0015376_1169_1591 140
64 3300046542 Ga0495597_0204657 Ga0495597_0204657_233_655 140
65 3300046616 Ga0495668_0004222 Ga0495668_0004222_2857_3279 140
66 3300047472 Ga0495686_0000870 Ga0495686_0000870_13088_13510 140
67 3300049459 Ga0495678_001114 Ga0495678_001114_1005_1472 140
68 3300053086 Ga0500578_0000124 Ga0500578_0000124_43329_43796 140
69 3300053108 Ga0500562_000984 Ga0500562_000984_2486_2908 140
70 3300053118 Ga0500594_0000130 Ga0500594_0000130_12424_12891 140
71 3300053156 Ga0500622_0001273 Ga0500622_0001273_13637_14059 140
72 3300005327 Ga0070658_10582997 Ga0070658_105829972 141
73 3300005337 Ga0070682_101505977 Ga0070682_1015059771 141
74 3300005339 Ga0070660_100117670 Ga0070660_1001176703 141
75 3300005564 Ga0070664_100118800 Ga0070664_1001188004 141
76 3300011119 Ga0105246_11587051 Ga0105246_115870512 141
77 3300013296 Ga0157374_10860264 Ga0157374_108602642 141
78 3300015262 Ga0182007_10189938 Ga0182007_101899381 141
79 3300025909 Ga0207705_10537825 Ga0207705_105378252 141
80 3300025919 Ga0207657_10078857 Ga0207657_100788573 141
81 3300025932 Ga0207690_10280484 Ga0207690_102804842 141
82 3300039438 Ga0436360_1107635 Ga0436360_1107635_1852_2295 141
83 3300047472 Ga0495686_0034366 Ga0495686_0034366_473_901 141
84 3300048927 Ga0496124_0800274 Ga0496124_0800274_36_473 141
85 iso_pu_bacteria 8005258706 8005259017 141
86 3300003771 Ga0055526_1063845 Ga0055526_10638451 142
87 3300005455 Ga0070663_100326903 Ga0070663_1003269031 142
88 3300005548 Ga0070665_100031526 Ga0070665_1000315267 142
89 3300005578 Ga0068854_102122433 Ga0068854_1021224331 142
90 3300005614 Ga0068856_100122928 Ga0068856_1001229282 142
91 3300005614 Ga0068856_100903610 Ga0068856_1009036101 142
92 3300006051 Ga0075364_10407228 Ga0075364_104072282 142
93 3300007265 Ga0099794_10105383 Ga0099794_101053831 142
94 3300009177 Ga0105248_10457306 Ga0105248_104573061 142
95 3300009545 Ga0105237_11681305 Ga0105237_116813051 142
96 3300009551 Ga0105238_10233625 Ga0105238_102336252 142
97 3300010375 Ga0105239_10562274 Ga0105239_105622743 142
98 3300025295 Ga0209564_1000290 Ga0209564_100029074 142
99 3300025900 Ga0207710_10017202 Ga0207710_100172024 142
100 3300025924 Ga0207694_10183289 Ga0207694_101832892 142
101 3300026035 Ga0207703_10592473 Ga0207703_105924731 142
102 3300026067 Ga0207678_10503110 Ga0207678_105031102 142
103 3300026078 Ga0207702_10717665 Ga0207702_107176652 142
104 3300028379 Ga0268266_10034676 Ga0268266_100346763 142
105 3300028794 Ga0307515_10385253 Ga0307515_103852532 142
106 3300030736 Ga0316180_1010042 Ga0316180_10100422 142
107 3300031548 Ga0307408_100457310 Ga0307408_1004573101 142
108 3300041405 Ga0439438_087691 Ga0439438_087691_110_556 142
109 3300041459 Ga0451800_0677143 Ga0451800_0677143_102_548 142
110 3300042010 Ga0439452_082301 Ga0439452_082301_194_640 142
111 3300042115 Ga0450911_041058 Ga0450911_041058_40_486 142
112 3300042122 Ga0450920_013668 Ga0450920_013668_803_1231 142
113 3300042146 Ga0450907_030840 Ga0450907_030840_62_508 142
114 3300044683 Ga0466965_0038093 Ga0466965_0038093_603_1031 142
115 3300046460 Ga0495638_0000317 Ga0495638_0000317_43640_44068 142
116 3300046543 Ga0495645_0224710 Ga0495645_0224710_461_916 142
117 3300046660 Ga0495625_0001966 Ga0495625_0001966_15666_16178 142
118 3300047472 Ga0495686_0512648 Ga0495686_0512648_140_568 142
119 3300048909 Ga0496106_0003594 Ga0496106_0003594_6868_7371 142
120 3300048910 Ga0496107_0000087 Ga0496107_0000087_34305_34808 142
121 3300048920 Ga0496117_0146006 Ga0496117_0146006_530_976 142
122 3300048924 Ga0496121_0003749 Ga0496121_0003749_17715_18218 142
123 3300048927 Ga0496124_0214516 Ga0496124_0214516_851_1297 142
124 3300048928 Ga0496125_0279791 Ga0496125_0279791_435_881 142
125 3300048929 Ga0496126_0792964 Ga0496126_0792964_187_633 142
126 3300049569 Ga0501032_0135137 Ga0501032_0135137_496_930 142
127 3300049580 Ga0501046_0152330 Ga0501046_0152330_818_1252 142
128 3300049581 Ga0501047_0383145 Ga0501047_0383145_665_1099 142
129 3300049822 Ga0501035_0224735 Ga0501035_0224735_1144_1578 142
130 3300049823 Ga0501044_0276391 Ga0501044_0276391_372_806 142
131 3300053094 Ga0500566_0108084 Ga0500566_0108084_978_1406 142
132 3300053122 Ga0500608_034080 Ga0500608_034080_593_1021 142
133 3300053125 Ga0500618_000195 Ga0500618_000195_38600_39028 142
134 3300053156 Ga0500622_0022082 Ga0500622_0022082_1960_2388 142
135 3300005841 Ga0068863_101476174 Ga0068863_1014761742 143
136 3300005842 Ga0068858_100000408 Ga0068858_10000040838 143
137 3300006852 Ga0075433_10556462 Ga0075433_105564622 143
138 3300006871 Ga0075434_100982710 Ga0075434_1009827101 143
139 3300025294 Ga0209025_1005648 Ga0209025_10056488 143
140 3300025909 Ga0207705_10932148 Ga0207705_109321481 143
141 3300025921 Ga0207652_10335105 Ga0207652_103351053 143
142 3300026035 Ga0207703_10000171 Ga0207703_100001719 143
143 3300028794 Ga0307515_10043313 Ga0307515_100433134 143
144 3300035086 Ga0373934_0186925 Ga0373934_0186925_231_668 143
145 3300035724 Ga0373933_0201655 Ga0373933_0201655_92_535 143
146 3300036401 Ga0373937_0042803 Ga0373937_0042803_2556_2999 143
147 3300044658 Ga0466972_0035174 Ga0466972_0035174_1992_2438 143
148 3300044901 Ga0466960_0110247 Ga0466960_0110247_511_957 143
149 3300045049 Ga0466959_0010849 Ga0466959_0010849_489_941 143
150 3300046463 Ga0495653_0508652 Ga0495653_0508652_145_588 143
151 3300046511 Ga0495608_0057960 Ga0495608_0057960_1491_1934 143
152 3300046559 Ga0495667_0001239 Ga0495667_0001239_11700_12143 143
153 3300046616 Ga0495668_0505202 Ga0495668_0505202_127_558 143
154 3300046675 Ga0495657_0001568 Ga0495657_0001568_8155_8598 143
155 3300047471 Ga0495684_0073045 Ga0495684_0073045_1402_1845 143
156 3300048912 Ga0496109_1640274 Ga0496109_1640274_65_511 143
157 3300049586 Ga0501070_0170501 Ga0501070_0170501_400_870 143
158 3300050512 nmdc:mga0n895_383870_c1 nmdc:mga0n895_383870_c1_216_650 143
159 3300050515 nmdc:mga0a205_241170_c1 nmdc:mga0a205_241170_c1_250_684 143
160 3300002705 JGI25156J39149_1000364 JGI25156J39149_100036427 145
161 3300002741 JGI25157J39369_1000018 JGI25157J39369_1000018132 145
162 3300002772 JGI25164J39214_1006506 JGI25164J39214_10065063 145
163 3300003752 Ga0055539_1000909 Ga0055539_10009094 145
164 3300005535 Ga0070684_100178430 Ga0070684_1001784303 145
165 3300005539 Ga0068853_100040579 Ga0068853_1000405795 145
166 3300005563 Ga0068855_100079629 Ga0068855_1000796293 145
167 3300005563 Ga0068855_100334569 Ga0068855_1003345693 145
168 3300005577 Ga0068857_100007724 Ga0068857_1000077248 145
169 3300005578 Ga0068854_100063830 Ga0068854_1000638304 145
170 3300005614 Ga0068856_100015909 Ga0068856_1000159099 145
171 3300009093 Ga0105240_10093540 Ga0105240_100935404 145
172 3300009174 Ga0105241_10785292 Ga0105241_107852922 145
173 3300009545 Ga0105237_10526982 Ga0105237_105269823 145
174 3300010375 Ga0105239_10728527 Ga0105239_107285273 145
175 3300013105 Ga0157369_10027930 Ga0157369_100279302 145
176 3300013307 Ga0157372_10149842 Ga0157372_101498421 145
177 3300025231 Ga0207427_102840 Ga0207427_1028404 145
178 3300025242 Ga0209258_101823 Ga0209258_1018235 145
179 3300025246 Ga0209646_1000067 Ga0209646_100006766 145
180 3300025250 Ga0209026_1000033 Ga0209026_1000033164 145
181 3300025253 Ga0209677_100196 Ga0209677_10019616 145
182 3300025253 Ga0209677_101156 Ga0209677_1011564 145
183 3300025256 Ga0209759_1000024 Ga0209759_1000024164 145
184 3300025911 Ga0207654_10195107 Ga0207654_101951073 145
185 3300025913 Ga0207695_10018205 Ga0207695_100182053 145
186 3300025924 Ga0207694_10063893 Ga0207694_100638935 145
187 3300026041 Ga0207639_10219429 Ga0207639_102194291 145
188 3300026078 Ga0207702_10001078 Ga0207702_1000107833 145
189 3300026116 Ga0207674_10022586 Ga0207674_100225865 145
190 3300026142 Ga0207698_10462357 Ga0207698_104623572 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

32

167

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9875 4 142
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9597 4 142
3ibv-assembly1.cif.gz_A karyopherin cytosolic state 0.4027 60 131
7rqf-assembly2.cif.gz_B crystal structure of lbca (lipoprotein binding partner of ctpa) of pseudomonas aeruginosa 0.3884 58 143
6b4g-assembly4.cif.gz_G crystal structure of chaetomium thermophilum gle1 ctd-nup42 gbm complex 0.373 47 144
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9875 4 142 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9597 4 142 1.25.40.380
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5449 2 128 1.25.10.10
af_D3ZL50_116_216_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5036 57 133 1.25.40.10
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4899 2 128 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2S9GFW1-F1-model_v4 DUF1810 domain-containing protein 1.001 29 110
AF-A0A1H7GQQ3-F1-model_v4 Calpastatin 1 6 84
AF-A0A372DN98-F1-model_v4 DUF1810 domain-containing protein 0.9962 5 142
AF-A0A0Q5ETY2-F1-model_v4 deleted 0.9938 6 142
AF-A0A7Y4SQ63-F1-model_v4 DUF1810 domain-containing protein 0.9936 7 145

Feature Viewer

pLDDT pTM Quality
93.55 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map