F292954

General Info

Members Datasets Scaffolds Average Seq Length
190 143 380 139

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0130043|Ga0466960_0130043_729_1214
Length 161
Sequence MRPAGPGKRLGDREENPMPKTTKSGTAKKEELPGTLRRSDKKAQRTYAKAHDSAVQSYGEGRRAHQTAMAALKHTHEKVGDHWEPKPGGKKGPSDAQAKGGKGTNRKTAGGVDANASKSHLQDVAKKLDISGRSKMGKKELVEAIQKANDRKTAKARAGKS

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 2739367653 Kocuria sp. OV113 Isolate Unclassified
139 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
140 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
141 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
142 2857727296 Kocuria sp. R-72562 Isolate Unclassified
143 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.53
Metatranscriptomes 6.32
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0.53
Rhizoplane 9.47
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0130043 3300044901 Bacteria 1328
2 JGI24735J21928_10185085 3300002067 Bacteria 603
3 Ga0070683_100965460 3300005329 Bacteria 818
4 Ga0070683_102099570 3300005329 Bacteria 543
5 Ga0070670_100541302 3300005331 Bacteria 1038
6 Ga0070682_101330691 3300005337 Bacteria 611
7 Ga0070660_100282756 3300005339 Bacteria 1358
8 Ga0070661_100910792 3300005344 Bacteria 726
9 Ga0070669_100000960 3300005353 Bacteria 21054
10 Ga0070667_100001425 3300005367 Bacteria 21427
11 Ga0070662_100352970 3300005457 Bacteria 1205
12 Ga0070681_10662461 3300005458 Bacteria 959
13 Ga0070679_100159127 3300005530 Bacteria 2233
14 Ga0070679_100222072 3300005530 Bacteria 1850
15 Ga0070679_100389528 3300005530 Bacteria 1340
16 Ga0070684_100475783 3300005535 Bacteria 1156
17 Ga0070684_100763635 3300005535 Bacteria 903
18 Ga0070696_100007270 3300005546 Bacteria 7391
19 Ga0070665_100049147 3300005548 Bacteria 4232
20 Ga0068857_100259508 3300005577 Bacteria 1594
21 Ga0068856_100292415 3300005614 Bacteria 1646
22 Ga0068859_100003309 3300005617 Bacteria 16370
23 Ga0068864_100729399 3300005618 Bacteria 970
24 Ga0068864_101816095 3300005618 Bacteria 615
25 Ga0068863_100001428 3300005841 Bacteria 23666
26 Ga0068858_100051932 3300005842 Bacteria 3793
27 Ga0068858_101411252 3300005842 Bacteria 686
28 Ga0068860_100002016 3300005843 Bacteria 21427
29 Ga0068862_100000035 3300005844 Bacteria 174953
30 Ga0070717_10734128 3300006028 Bacteria 898
31 Ga0075365_10041673 3300006038 Bacteria 3001
32 Ga0075364_10040746 3300006051 Bacteria 3013
33 Ga0097620_100003309 3300006931 Bacteria 16370
34 Ga0111539_10068707 3300009094 Bacteria 4183
35 Ga0105245_10225224 3300009098 Bacteria 1811
36 Ga0105247_10000952 3300009101 Bacteria 21847
37 Ga0105248_10002237 3300009177 Bacteria 21398
38 Ga0105237_10060239 3300009545 Bacteria 3798
39 Ga0105238_10736873 3300009551 Bacteria 999
40 Ga0105249_10000046 3300009553 Bacteria 176363
41 Ga0105239_10229395 3300010375 Bacteria 2083
42 Ga0163162_10019492 3300013306 Bacteria 6655
43 Ga0163162_10189841 3300013306 Bacteria 2182
44 Ga0157375_10733011 3300013308 Bacteria 1140
45 Ga0163163_10020015 3300014325 Bacteria 6296
46 Ga0163163_10252235 3300014325 Bacteria 1815
47 Ga0157379_10362903 3300014968 Bacteria 1328
48 Ga0206356_10119039 3300020070 Bacteria 1214
49 Ga0206356_10365162 3300020070 Bacteria 610
50 Ga0206356_11672926 3300020070 Bacteria 588
51 Ga0206350_11542579 3300020080 Bacteria 556
52 Ga0206354_10236413 3300020081 Bacteria 900
53 Ga0206354_10751532 3300020081 Bacteria 1473
54 Ga0206354_10968778 3300020081 Bacteria 1362
55 Ga0206353_10857669 3300020082 Bacteria 1640
56 Ga0206353_11944245 3300020082 Bacteria 2656
57 Ga0206353_11980014 3300020082 Bacteria 1224
58 Ga0213875_10405480 3300021388 Bacteria 650
59 Ga0224712_10582490 3300022467 Bacteria 545
60 Ga0207710_10000153 3300025900 Bacteria 76530
61 Ga0207688_10401906 3300025901 Bacteria 850
62 Ga0207707_10725859 3300025912 Bacteria 833
63 Ga0207671_10244858 3300025914 Bacteria 1409
64 Ga0207657_10135187 3300025919 Bacteria 2018
65 Ga0207652_10172723 3300025921 Bacteria 1940
66 Ga0207652_10275939 3300025921 Bacteria 1516
67 Ga0207681_10000615 3300025923 Bacteria 23920
68 Ga0207694_10518513 3300025924 Bacteria 999
69 Ga0207709_10738106 3300025935 Bacteria 791
70 Ga0207711_10001535 3300025941 Bacteria 21402
71 Ga0207712_10000042 3300025961 Bacteria 176338
72 Ga0207658_10000377 3300025986 Bacteria 43514
73 Ga0207703_10005964 3300026035 Bacteria 9761
74 Ga0207703_11178775 3300026035 Bacteria 736
75 Ga0207678_10518736 3300026067 Bacteria 1040
76 Ga0207641_10001215 3300026088 Bacteria 25767
77 Ga0207676_10660148 3300026095 Bacteria 1010
78 Ga0207676_11161870 3300026095 Bacteria 764
79 Ga0207674_10188100 3300026116 Bacteria 2015
80 Ga0207675_100406585 3300026118 Bacteria 1342
81 Ga0268266_10097580 3300028379 Bacteria 2584
82 Ga0268265_10000051 3300028380 Bacteria 174968
83 Ga0268264_10000108 3300028381 Bacteria 208791
84 Ga0307408_100233819 3300031548 Bacteria 1507
85 Ga0316575_10417986 3300031665 Bacteria 576
86 Ga0316579_10532235 3300031691 Bacteria 569
87 Ga0316576_10105478 3300031727 Bacteria 2109
88 Ga0316577_10335354 3300031733 Bacteria 858
89 Ga0307413_10493413 3300031824 Bacteria 982
90 Ga0307413_10637928 3300031824 Bacteria 877
91 Ga0307410_10070263 3300031852 Bacteria 2425
92 Ga0307407_10141643 3300031903 Bacteria 1552
93 Ga0307407_10435517 3300031903 Bacteria 948
94 Ga0307407_10724866 3300031903 Bacteria 751
95 Ga0307412_11052537 3300031911 Bacteria 722
96 Ga0307412_11543776 3300031911 Bacteria 605
97 Ga0307409_100105059 3300031995 Bacteria 2354
98 Ga0307409_100191860 3300031995 Bacteria 1819
99 Ga0307409_100481747 3300031995 Bacteria 1204
100 Ga0307409_101963158 3300031995 Bacteria 615
101 Ga0307416_100707626 3300032002 Bacteria 1097
102 Ga0307414_10738692 3300032004 Bacteria 894
103 Ga0307415_100655234 3300032126 Bacteria 942
104 Ga0307415_100817065 3300032126 Bacteria 852
105 Ga0307415_100834950 3300032126 Bacteria 844
106 Ga0316580_10103675 3300032139 Bacteria 871
107 Ga0316574_0022067 3300035398 Bacteria 3788
108 Ga0316582_0566402 3300036647 Bacteria 782
109 Ga0316584_0034597 3300036712 Bacteria 3745
110 Ga0395900_0591909 3300037418 Bacteria 1050
111 Ga0395898_0825261 3300037466 Bacteria 867
112 Ga0436364_0389722 3300037853 Bacteria 1171
113 Ga0395901_0417645 3300038443 Bacteria 1376
114 Ga0395901_0909588 3300038443 Bacteria 861
115 Ga0395901_1175786 3300038443 Bacteria 734
116 Ga0436365_1191375 3300039437 Bacteria 5365
117 Ga0436363_0682758 3300039450 Bacteria 2347
118 Ga0436363_0815164 3300039450 Bacteria 1017
119 Ga0439466_0011249 3300041411 Bacteria 3313
120 Ga0451791_0126797 3300041451 Bacteria 663
121 Ga0451793_0824494 3300041452 Bacteria 639
122 Ga0451833_0963460 3300041491 Bacteria 1686
123 Ga0451843_1245939 3300041509 Bacteria 3748
124 Ga0466972_0052407 3300044658 Bacteria 1966
125 Ga0466972_0093803 3300044658 Bacteria 1423
126 Ga0466965_0018060 3300044683 Bacteria 3376
127 Ga0466965_0073852 3300044683 Bacteria 1718
128 Ga0466965_0089906 3300044683 Bacteria 1561
129 Ga0466965_0098711 3300044683 Bacteria 1492
130 Ga0466963_0385291 3300044694 Bacteria 988
131 Ga0466964_0124371 3300044706 Bacteria 1167
132 Ga0466968_0020848 3300044735 Bacteria 2649
133 Ga0466970_0616089 3300044765 Bacteria 630
134 Ga0466957_0007571 3300044842 Bacteria 6137
135 Ga0466957_0808343 3300044842 Bacteria 666
136 Ga0466960_0010891 3300044901 Bacteria 3786
137 Ga0466960_0131060 3300044901 Bacteria 1323
138 Ga0466960_0377561 3300044901 Bacteria 813
139 Ga0466958_0014488 3300045836 Bacteria 4502
140 Ga0466958_0312396 3300045836 Bacteria 1010
141 Ga0466967_0123420 3300045976 Bacteria 2396
142 Ga0466967_0597012 3300045976 Bacteria 1089
143 Ga0466967_1159594 3300045976 Bacteria 770
144 Ga0466967_1787069 3300045976 Bacteria 612
145 Ga0466967_2133044 3300045976 Bacteria 557
146 Ga0496100_0828584 3300048903 Bacteria 725
147 Ga0496101_0004844 3300048904 Bacteria 8536
148 Ga0496102_0000131 3300048905 Bacteria 104032
149 Ga0496102_0469802 3300048905 Bacteria 1179
150 Ga0496103_0000859 3300048906 Bacteria 22103
151 Ga0496104_0686855 3300048907 Bacteria 932
152 Ga0496105_0118266 3300048908 Bacteria 2186
153 Ga0496105_0867889 3300048908 Bacteria 682
154 Ga0496106_1150876 3300048909 Bacteria 606
155 Ga0496107_0011379 3300048910 Bacteria 6194
156 Ga0496109_0936024 3300048912 Bacteria 804
157 Ga0496110_0130401 3300048913 Bacteria 2270
158 Ga0496110_1017857 3300048913 Bacteria 736
159 Ga0496112_0226621 3300048915 Bacteria 1824
160 Ga0496113_0099217 3300048916 Bacteria 2255
161 Ga0496114_1363923 3300048917 Bacteria 596
162 Ga0496116_0002121 3300048919 Bacteria 21120
163 Ga0496117_0002770 3300048920 Bacteria 21471
164 Ga0496118_0002961 3300048921 Bacteria 21991
165 Ga0496119_0013033 3300048922 Bacteria 6673
166 Ga0496120_0007762 3300048923 Bacteria 7925
167 Ga0496121_0010397 3300048924 Bacteria 10503
168 Ga0496124_0037524 3300048927 Bacteria 4213
169 Ga0496126_0005120 3300048929 Bacteria 15192
170 Ga0501034_0510619 3300049571 Bacteria 1115
171 Ga0501038_0952023 3300049574 Bacteria 632
172 Ga0501043_0553388 3300049579 Bacteria 854
173 Ga0501068_0310642 3300049584 Bacteria 1010
174 Ga0501070_0078017 3300049586 Bacteria 2741
175 Ga0501073_0372687 3300049589 Bacteria 986
176 Ga0501080_0123383 3300049742 Bacteria 2400
177 Ga0501080_0407122 3300049742 Bacteria 1223
178 nmdc:mga00v17_15223_c1 3300050491 Bacteria 4312
179 nmdc:mga0yw44_34656_c2 3300050492 Bacteria 1726
180 nmdc:mga06r32_476477_c1 3300050510 Bacteria 1226
181 Ga0500604_0012029 3300053151 Bacteria 2333
182 Ga0500616_0005266 3300053153 Bacteria 8840
183 Ga0500616_0014734 3300053153 Bacteria 4485
184 Ga0587073_0088734 3300059492 Bacteria 782
185 2739603735 2739367653 Bacteria 2780952
186 2817510149 2816332305 Bacteria 2697803
187 2842140072 2842134933 Bacteria 5847019
188 2857710567 2857710386 Bacteria 3186771
189 2857727780 2857727296 Bacteria 2745552
190 2929216707 2929212328 Bacteria 7708288
191 Ga0466960_0130043
192 JGI24735J21928_10185085
193 Ga0070683_100965460
194 Ga0070683_102099570
195 Ga0070670_100541302
196 Ga0070682_101330691
197 Ga0070660_100282756
198 Ga0070661_100910792
199 Ga0070669_100000960
200 Ga0070667_100001425
201 Ga0070662_100352970
202 Ga0070681_10662461
203 Ga0070679_100159127
204 Ga0070679_100222072
205 Ga0070679_100389528
206 Ga0070684_100475783
207 Ga0070684_100763635
208 Ga0070696_100007270
209 Ga0070665_100049147
210 Ga0068857_100259508
211 Ga0068856_100292415
212 Ga0068859_100003309
213 Ga0068864_100729399
214 Ga0068864_101816095
215 Ga0068863_100001428
216 Ga0068858_100051932
217 Ga0068858_101411252
218 Ga0068860_100002016
219 Ga0068862_100000035
220 Ga0070717_10734128
221 Ga0075365_10041673
222 Ga0075364_10040746
223 Ga0097620_100003309
224 Ga0111539_10068707
225 Ga0105245_10225224
226 Ga0105247_10000952
227 Ga0105248_10002237
228 Ga0105237_10060239
229 Ga0105238_10736873
230 Ga0105249_10000046
231 Ga0105239_10229395
232 Ga0163162_10019492
233 Ga0163162_10189841
234 Ga0157375_10733011
235 Ga0163163_10020015
236 Ga0163163_10252235
237 Ga0157379_10362903
238 Ga0206356_10119039
239 Ga0206356_10365162
240 Ga0206356_11672926
241 Ga0206350_11542579
242 Ga0206354_10236413
243 Ga0206354_10751532
244 Ga0206354_10968778
245 Ga0206353_10857669
246 Ga0206353_11944245
247 Ga0206353_11980014
248 Ga0213875_10405480
249 Ga0224712_10582490
250 Ga0207710_10000153
251 Ga0207688_10401906
252 Ga0207707_10725859
253 Ga0207671_10244858
254 Ga0207657_10135187
255 Ga0207652_10172723
256 Ga0207652_10275939
257 Ga0207681_10000615
258 Ga0207694_10518513
259 Ga0207709_10738106
260 Ga0207711_10001535
261 Ga0207712_10000042
262 Ga0207658_10000377
263 Ga0207703_10005964
264 Ga0207703_11178775
265 Ga0207678_10518736
266 Ga0207641_10001215
267 Ga0207676_10660148
268 Ga0207676_11161870
269 Ga0207674_10188100
270 Ga0207675_100406585
271 Ga0268266_10097580
272 Ga0268265_10000051
273 Ga0268264_10000108
274 Ga0307408_100233819
275 Ga0316575_10417986
276 Ga0316579_10532235
277 Ga0316576_10105478
278 Ga0316577_10335354
279 Ga0307413_10493413
280 Ga0307413_10637928
281 Ga0307410_10070263
282 Ga0307407_10141643
283 Ga0307407_10435517
284 Ga0307407_10724866
285 Ga0307412_11052537
286 Ga0307412_11543776
287 Ga0307409_100105059
288 Ga0307409_100191860
289 Ga0307409_100481747
290 Ga0307409_101963158
291 Ga0307416_100707626
292 Ga0307414_10738692
293 Ga0307415_100655234
294 Ga0307415_100817065
295 Ga0307415_100834950
296 Ga0316580_10103675
297 Ga0316574_0022067
298 Ga0316582_0566402
299 Ga0316584_0034597
300 Ga0395900_0591909
301 Ga0395898_0825261
302 Ga0436364_0389722
303 Ga0395901_0417645
304 Ga0395901_0909588
305 Ga0395901_1175786
306 Ga0436365_1191375
307 Ga0436363_0682758
308 Ga0436363_0815164
309 Ga0439466_0011249
310 Ga0451791_0126797
311 Ga0451793_0824494
312 Ga0451833_0963460
313 Ga0451843_1245939
314 Ga0466972_0052407
315 Ga0466972_0093803
316 Ga0466965_0018060
317 Ga0466965_0073852
318 Ga0466965_0089906
319 Ga0466965_0098711
320 Ga0466963_0385291
321 Ga0466964_0124371
322 Ga0466968_0020848
323 Ga0466970_0616089
324 Ga0466957_0007571
325 Ga0466957_0808343
326 Ga0466960_0010891
327 Ga0466960_0131060
328 Ga0466960_0377561
329 Ga0466958_0014488
330 Ga0466958_0312396
331 Ga0466967_0123420
332 Ga0466967_0597012
333 Ga0466967_1159594
334 Ga0466967_1787069
335 Ga0466967_2133044
336 Ga0496100_0828584
337 Ga0496101_0004844
338 Ga0496102_0000131
339 Ga0496102_0469802
340 Ga0496103_0000859
341 Ga0496104_0686855
342 Ga0496105_0118266
343 Ga0496105_0867889
344 Ga0496106_1150876
345 Ga0496107_0011379
346 Ga0496109_0936024
347 Ga0496110_0130401
348 Ga0496110_1017857
349 Ga0496112_0226621
350 Ga0496113_0099217
351 Ga0496114_1363923
352 Ga0496116_0002121
353 Ga0496117_0002770
354 Ga0496118_0002961
355 Ga0496119_0013033
356 Ga0496120_0007762
357 Ga0496121_0010397
358 Ga0496124_0037524
359 Ga0496126_0005120
360 Ga0501034_0510619
361 Ga0501038_0952023
362 Ga0501043_0553388
363 Ga0501068_0310642
364 Ga0501070_0078017
365 Ga0501073_0372687
366 Ga0501080_0123383
367 Ga0501080_0407122
368 nmdc:mga00v17_15223_c1
369 nmdc:mga0yw44_34656_c2
370 nmdc:mga06r32_476477_c1
371 Ga0500604_0012029
372 Ga0500616_0005266
373 Ga0500616_0014734
374 Ga0587073_0088734
375 2739603735
376 2817510149
377 2842140072
378 2857710567
379 2857727780
380 2929216707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06150

ChaB

ChaB

32

86

0.98

PF07498

Rho_N

Rho termination factor, N-terminal domain

117

153

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8v-assembly2.cif.gz_B rho transcription termination factor/rna complex 0.9054 96 132
1a8v-assembly1.cif.gz_A structure of the rna-binding domain of the rho transcription terminator 0.9021 95 132
4j7z-assembly3.cif.gz_C thermus thermophilus dnaj j- and g/f-domains 0.3951 91 136
2ctp-assembly1.cif.gz_A solution structure of j-domain from human dnaj subfamily b menber 12 0.35 84 131
7c8o-assembly1.cif.gz_D crystal structure of iscu d40a/h106a variant 0.3307 49 138
ID Description Score Start End Superfamily
af_Q2FWD7_13_140_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9773 96 129 2.40.50.140
2a8vA01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.9183 96 132 1.10.720.10
2a8vC01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.916 96 132 1.10.720.10
1a8vB01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.9093 96 132 1.10.720.10
2a8vB01 Mainly Alpha;Orthogonal Bundle;Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1; 0.9054 96 132 1.10.720.10
ID Description Score Start End GO Terms
AF-A0A1H7I6L0-F1-model_v4 Uncharacterized conserved protein, DUF2252 family 1.02 97 129
AF-A0A177R526-F1-model_v4 deleted 1.015 97 127
AF-A0A6C7E889-F1-model_v4 Rho termination factor-like N-terminal domain-containing protein 1.014 97 129 GO:0006353
AF-A0A1I1KN54-F1-model_v4 Uncharacterized conserved protein, DUF2252 family 1.014 97 128
AF-A7GI69-F1-model_v4 Conserved domain protein (EC 3.6.1.-) 1.01 97 127 GO:0006353
GO:0016787

Map