F292204

General Info

Members Datasets Scaffolds Average Seq Length
190 135 380 452

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100131256|Ga0068856_1001312562
Length 501
Sequence VKSAVETLNPTRVKLTVEVPFEELKPSLDAAYKKIGQQITIPGFRRGKVPALVIDQRIGRGAVLDEAVNDALPKMYMQALQDNNIVPLSSPELDLDEFQDGSPLNFSAELDVKPEITVPDYTGIEVEVDDIVVGDDEVDEQMESLRERFGTLTPVDRAAADGDFVTIDLSAARDGEQIEEAQATGMSYQVGRGTMLEGLDEALVGMAAGDEATFSSTLVGGEYKDQMVDVTVRLTAVREQELPDLDDEFAQNASEFDTVAELKDDLRERLVRSARVEQAAAARDAVLEKLLTMVEVPLPDAAVAEELKSRRDSIDEQLAYAGMSEADYLESEGQNEDEFAADLEKRVRDAMAAQFLLDEIANAEALGVDEGELTQHLLRRAQQAGQSPEEYVKHVMEHNHVPELVAEIRRGKALARVVESATVTDASGNVVELKTLQPDGTYAEPGAVDDDSEDGRAVESAEETQPPVARDASADIQVLGGSDFVRVEDAADPQEKPAGDA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2643221590 Nocardioides sp. Root682 Isolate Unclassified
125 2643221604 Nocardioides sp. Root190 Isolate Unclassified
126 2643221615 Nocardioides sp. Root224 Isolate Unclassified
127 2643221617 Nocardioides sp. Root79 Isolate Unclassified
128 2643221620 Nocardioides sp. Root240 Isolate Unclassified
129 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
130 2738541305 Nocardioides sp. CF167 Isolate Unclassified
131 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
132 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
133 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
134 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
135 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.95
Metatranscriptomes 4.74
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.37
Nodule 0
Rhizoplane 4.21
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100131256 3300005614 Bacteria 2510
2 JGI24740J21852_10030654 3300001979 Bacteria 1746
3 JGI24739J22299_10012289 3300001989 Bacteria 3144
4 JGI24737J22298_10033468 3300001990 Bacteria 1596
5 Ga0006562J51391_1114835 3300003578 Bacteria 1881
6 Ga0070683_100030501 3300005329 Bacteria 4896
7 Ga0070683_100055009 3300005329 Bacteria 3691
8 Ga0070683_100133395 3300005329 Bacteria 2350
9 Ga0070680_100058977 3300005336 Bacteria 3139
10 Ga0070660_100003302 3300005339 Bacteria 11087
11 Ga0070659_100080802 3300005366 Bacteria 2595
12 Ga0070659_100125207 3300005366 Bacteria 2085
13 Ga0070714_100060327 3300005435 Bacteria 3255
14 Ga0070678_100030699 3300005456 Bacteria 3697
15 Ga0070679_100020810 3300005530 Bacteria 6399
16 Ga0070679_100121644 3300005530 Bacteria 2594
17 Ga0070679_100240318 3300005530 Bacteria 1769
18 Ga0070684_100004672 3300005535 Bacteria 10459
19 Ga0070665_100000868 3300005548 Bacteria 39125
20 Ga0070664_100050661 3300005564 Bacteria 3515
21 Ga0070664_100054233 3300005564 Bacteria 3401
22 Ga0068857_100014013 3300005577 Bacteria 6976
23 Ga0068857_100218179 3300005577 Bacteria 1742
24 Ga0068856_100178694 3300005614 Bacteria 2135
25 Ga0068864_100020576 3300005618 Bacteria 5521
26 Ga0068860_100119265 3300005843 Bacteria 2525
27 Ga0081455_10020733 3300005937 Bacteria 6181
28 Ga0081539_10000170 3300005985 Bacteria 152854
29 Ga0081539_10001179 3300005985 Bacteria 47264
30 Ga0081539_10032457 3300005985 Bacteria 3198
31 Ga0075365_10129876 3300006038 Bacteria 1743
32 Ga0068871_100052455 3300006358 Bacteria 3303
33 Ga0075428_100022105 3300006844 Bacteria 7042
34 Ga0075430_100008427 3300006846 Bacteria 8709
35 Ga0075431_100001915 3300006847 Bacteria 19773
36 Ga0075429_100016458 3300006880 Bacteria 6408
37 Ga0111539_10234556 3300009094 Bacteria 2136
38 Ga0105245_10002262 3300009098 Bacteria 17436
39 Ga0114129_10038001 3300009147 Bacteria 6791
40 Ga0105243_10163999 3300009148 Bacteria 1918
41 Ga0105243_10207786 3300009148 Bacteria 1722
42 Ga0105237_10154361 3300009545 Bacteria 2292
43 Ga0105249_10102958 3300009553 Bacteria 2688
44 Ga0105239_10001318 3300010375 Bacteria 33415
45 Ga0105246_10000827 3300011119 Bacteria 17608
46 Ga0163162_10035603 3300013306 Bacteria 4960
47 Ga0157372_10027521 3300013307 Bacteria 6194
48 Ga0157375_10011560 3300013308 Bacteria 7799
49 Ga0157375_10147116 3300013308 Bacteria 2487
50 Ga0224712_10059802 3300022467 Bacteria 1514
51 Ga0207688_10008477 3300025901 Bacteria 5593
52 Ga0207647_10008541 3300025904 Bacteria 7334
53 Ga0207647_10010116 3300025904 Bacteria 6669
54 Ga0207647_10019973 3300025904 Bacteria 4497
55 Ga0207647_10036010 3300025904 Bacteria 3148
56 Ga0207647_10089796 3300025904 Bacteria 1833
57 Ga0207705_10023802 3300025909 Bacteria 4369
58 Ga0207705_10040023 3300025909 Bacteria 3360
59 Ga0207660_10054221 3300025917 Bacteria 2861
60 Ga0207657_10009110 3300025919 Bacteria 10012
61 Ga0207652_10146195 3300025921 Bacteria 2116
62 Ga0207687_10010027 3300025927 Bacteria 6198
63 Ga0207664_10046885 3300025929 Bacteria 3393
64 Ga0207690_10014894 3300025932 Bacteria 4706
65 Ga0207690_10204036 3300025932 Bacteria 1503
66 Ga0207711_10132976 3300025941 Bacteria 2232
67 Ga0207661_10005512 3300025944 Bacteria 8927
68 Ga0207661_10011381 3300025944 Bacteria 6444
69 Ga0207661_10156929 3300025944 Bacteria 1972
70 Ga0207667_10111443 3300025949 Bacteria 2822
71 Ga0207674_10007577 3300026116 Bacteria 12649
72 Ga0207674_10206281 3300026116 Bacteria 1915
73 Ga0207683_10052995 3300026121 Bacteria 3556
74 Ga0207698_10182974 3300026142 Bacteria 1858
75 Ga0268266_10001392 3300028379 Bacteria 28952
76 Ga0307410_10024711 3300031852 Bacteria 3758
77 Ga0307410_10132790 3300031852 Bacteria 1831
78 Ga0307409_100069450 3300031995 Bacteria 2791
79 Ga0307415_100017095 3300032126 Bacteria 4341
80 Ga0316596_1007562 3300033541 Bacteria 2573
81 Ga0316574_0034945 3300035398 Bacteria 3068
82 Ga0395898_0019494 3300037466 Bacteria 6901
83 Ga0395905_0012411 3300037471 Bacteria 8201
84 Ga0395901_0146879 3300038443 Bacteria 2478
85 Ga0395901_0240926 3300038443 Bacteria 1886
86 Ga0466969_0004974 3300044656 Bacteria 7078
87 Ga0466965_0000715 3300044683 Bacteria 12381
88 Ga0466965_0022122 3300044683 Bacteria 3065
89 Ga0466966_0061409 3300044684 Bacteria 2371
90 Ga0466961_0011852 3300044693 Bacteria 5572
91 Ga0466961_0075967 3300044693 Bacteria 2129
92 Ga0466963_0066896 3300044694 Bacteria 2411
93 Ga0466964_0017457 3300044706 Bacteria 2746
94 Ga0466964_0017758 3300044706 Bacteria 2725
95 Ga0466964_0051420 3300044706 Bacteria 1692
96 Ga0466971_0006890 3300044719 Bacteria 4939
97 Ga0466970_0005535 3300044765 Bacteria 6273
98 Ga0466970_0023514 3300044765 Bacteria 3219
99 Ga0466970_0036192 3300044765 Bacteria 2614
100 Ga0466970_0048381 3300044765 Bacteria 2267
101 Ga0466957_0004703 3300044842 Bacteria 7638
102 Ga0466957_0012592 3300044842 Bacteria 4897
103 Ga0466960_0010425 3300044901 Bacteria 3861
104 Ga0466960_0015766 3300044901 Bacteria 3264
105 Ga0466960_0055087 3300044901 Bacteria 1933
106 Ga0466960_0078147 3300044901 Bacteria 1661
107 Ga0466959_0027110 3300045049 Bacteria 4250
108 Ga0466958_0013777 3300045836 Bacteria 4609
109 Ga0466958_0043754 3300045836 Bacteria 2697
110 Ga0466967_0067892 3300045976 Bacteria 3181
111 Ga0466967_0097863 3300045976 Bacteria 2678
112 Ga0466967_0151915 3300045976 Bacteria 2165
113 Ga0466967_0202606 3300045976 Bacteria 1880
114 Ga0496100_0020556 3300048903 Bacteria 3960
115 Ga0496100_0118371 3300048903 Bacteria 1850
116 Ga0496102_0015259 3300048905 Bacteria 6689
117 Ga0496102_0082654 3300048905 Bacteria 2962
118 Ga0496102_0361695 3300048905 Bacteria 1366
119 Ga0496103_0017558 3300048906 Bacteria 4283
120 Ga0496106_0060356 3300048909 Bacteria 2874
121 Ga0496113_0081430 3300048916 Bacteria 2481
122 Ga0496124_0002460 3300048927 Bacteria 24213
123 Ga0501311_004430 3300049527 Bacteria 1493
124 Ga0501316_003478 3300049532 Bacteria 1533
125 Ga0501317_003829 3300049533 Bacteria 1529
126 Ga0501321_001430 3300049537 Bacteria 1894
127 Ga0501321_002355 3300049537 Bacteria 1630
128 Ga0501322_000648 3300049538 Bacteria 1710
129 Ga0501036_0006122 3300049572 Bacteria 9765
130 Ga0501036_0022196 3300049572 Bacteria 5338
131 Ga0501036_0026550 3300049572 Bacteria 4889
132 Ga0501037_0029796 3300049573 Bacteria 4032
133 Ga0501037_0061333 3300049573 Bacteria 2742
134 Ga0501038_0000986 3300049574 Bacteria 25579
135 Ga0501039_0076255 3300049575 Bacteria 2606
136 Ga0501040_0006704 3300049576 Bacteria 7468
137 Ga0501041_0024640 3300049577 Bacteria 3611
138 Ga0501042_0012330 3300049578 Bacteria 5786
139 Ga0501042_0196658 3300049578 Bacteria 1454
140 Ga0501046_0044895 3300049580 Bacteria 3513
141 Ga0501047_0013895 3300049581 Bacteria 7645
142 Ga0501048_0011025 3300049582 Bacteria 6743
143 Ga0501067_0081967 3300049583 Bacteria 1788
144 Ga0501068_0058331 3300049584 Bacteria 2342
145 Ga0501068_0123305 3300049584 Bacteria 1617
146 Ga0501069_0063216 3300049585 Bacteria 2067
147 Ga0501070_0001766 3300049586 Bacteria 19131
148 Ga0501070_0015466 3300049586 Bacteria 6420
149 Ga0501072_0094414 3300049588 Bacteria 2376
150 Ga0501073_0062472 3300049589 Bacteria 2598
151 Ga0501074_0009114 3300049590 Bacteria 7208
152 Ga0501075_0014401 3300049591 Bacteria 5666
153 Ga0501076_0006498 3300049592 Bacteria 8483
154 Ga0501080_0058672 3300049742 Bacteria 3582
155 Ga0501080_0109820 3300049742 Bacteria 2556
156 Ga0501081_0044258 3300049743 Bacteria 3055
157 Ga0501035_0008456 3300049822 Bacteria 9587
158 Ga0501035_0063030 3300049822 Bacteria 3298
159 Ga0501044_0005123 3300049823 Bacteria 14617
160 Ga0501044_0074824 3300049823 Bacteria 3439
161 Ga0501045_0182431 3300049824 Bacteria 1564
162 nmdc:mga03683_7638_c1 3300050489 Bacteria 3764
163 nmdc:mga03n38_5110_c1 3300050490 Bacteria 4429
164 nmdc:mga00v17_17669_c1 3300050491 Bacteria 4043
165 nmdc:mga00v17_7944_c1 3300050491 Bacteria 5687
166 nmdc:mga0yw44_111820_c1 3300050492 Bacteria 1751
167 nmdc:mga0yw44_24757_c1 3300050492 Bacteria 3402
168 nmdc:mga0yw44_3401_c1 3300050492 Bacteria 7063
169 nmdc:mga07m45_14283_c1 3300050496 Bacteria 4226
170 nmdc:mga07m45_5541_c1 3300050496 Bacteria 6297
171 nmdc:mga05p37_17900_c1 3300050507 Bacteria 8553
172 nmdc:mga06r32_25771_c1 3300050510 Bacteria 5474
173 Ga0500644_0000315 3300053088 Bacteria 25229
174 Ga0500556_0001592 3300053104 Bacteria 9040
175 Ga0500593_000520 3300053117 Bacteria 15117
176 Ga0500568_0007321 3300053139 Bacteria 5425
177 Ga0501082_0098068 3300060353 Bacteria 2534
178 Ga0466962_0005850 3300061719 Bacteria 5910
179 2643961479 2643221590 Bacteria 5214697
180 2644032414 2643221604 Bacteria 5014917
181 2644090748 2643221615 Bacteria 5487866
182 2644102698 2643221617 Bacteria 5139111
183 2644118360 2643221620 Bacteria 5134593
184 2644320552 2643221657 Bacteria 5490246
185 2738870587 2738541305 Bacteria 4910150
186 2812334131 2811994874 Bacteria 5367947
187 2816424502 2816332119 Bacteria 8120218
188 2891972182 2891968417 Bacteria 5821697
189 2915361625 2915358134 Bacteria 6050864
190 8054473286 8054472261 Bacteria 7464355
191 Ga0068856_100131256
192 JGI24740J21852_10030654
193 JGI24739J22299_10012289
194 JGI24737J22298_10033468
195 Ga0006562J51391_1114835
196 Ga0070683_100030501
197 Ga0070683_100055009
198 Ga0070683_100133395
199 Ga0070680_100058977
200 Ga0070660_100003302
201 Ga0070659_100080802
202 Ga0070659_100125207
203 Ga0070714_100060327
204 Ga0070678_100030699
205 Ga0070679_100020810
206 Ga0070679_100121644
207 Ga0070679_100240318
208 Ga0070684_100004672
209 Ga0070665_100000868
210 Ga0070664_100050661
211 Ga0070664_100054233
212 Ga0068857_100014013
213 Ga0068857_100218179
214 Ga0068856_100178694
215 Ga0068864_100020576
216 Ga0068860_100119265
217 Ga0081455_10020733
218 Ga0081539_10000170
219 Ga0081539_10001179
220 Ga0081539_10032457
221 Ga0075365_10129876
222 Ga0068871_100052455
223 Ga0075428_100022105
224 Ga0075430_100008427
225 Ga0075431_100001915
226 Ga0075429_100016458
227 Ga0111539_10234556
228 Ga0105245_10002262
229 Ga0114129_10038001
230 Ga0105243_10163999
231 Ga0105243_10207786
232 Ga0105237_10154361
233 Ga0105249_10102958
234 Ga0105239_10001318
235 Ga0105246_10000827
236 Ga0163162_10035603
237 Ga0157372_10027521
238 Ga0157375_10011560
239 Ga0157375_10147116
240 Ga0224712_10059802
241 Ga0207688_10008477
242 Ga0207647_10008541
243 Ga0207647_10010116
244 Ga0207647_10019973
245 Ga0207647_10036010
246 Ga0207647_10089796
247 Ga0207705_10023802
248 Ga0207705_10040023
249 Ga0207660_10054221
250 Ga0207657_10009110
251 Ga0207652_10146195
252 Ga0207687_10010027
253 Ga0207664_10046885
254 Ga0207690_10014894
255 Ga0207690_10204036
256 Ga0207711_10132976
257 Ga0207661_10005512
258 Ga0207661_10011381
259 Ga0207661_10156929
260 Ga0207667_10111443
261 Ga0207674_10007577
262 Ga0207674_10206281
263 Ga0207683_10052995
264 Ga0207698_10182974
265 Ga0268266_10001392
266 Ga0307410_10024711
267 Ga0307410_10132790
268 Ga0307409_100069450
269 Ga0307415_100017095
270 Ga0316596_1007562
271 Ga0316574_0034945
272 Ga0395898_0019494
273 Ga0395905_0012411
274 Ga0395901_0146879
275 Ga0395901_0240926
276 Ga0466969_0004974
277 Ga0466965_0000715
278 Ga0466965_0022122
279 Ga0466966_0061409
280 Ga0466961_0011852
281 Ga0466961_0075967
282 Ga0466963_0066896
283 Ga0466964_0017457
284 Ga0466964_0017758
285 Ga0466964_0051420
286 Ga0466971_0006890
287 Ga0466970_0005535
288 Ga0466970_0023514
289 Ga0466970_0036192
290 Ga0466970_0048381
291 Ga0466957_0004703
292 Ga0466957_0012592
293 Ga0466960_0010425
294 Ga0466960_0015766
295 Ga0466960_0055087
296 Ga0466960_0078147
297 Ga0466959_0027110
298 Ga0466958_0013777
299 Ga0466958_0043754
300 Ga0466967_0067892
301 Ga0466967_0097863
302 Ga0466967_0151915
303 Ga0466967_0202606
304 Ga0496100_0020556
305 Ga0496100_0118371
306 Ga0496102_0015259
307 Ga0496102_0082654
308 Ga0496102_0361695
309 Ga0496103_0017558
310 Ga0496106_0060356
311 Ga0496113_0081430
312 Ga0496124_0002460
313 Ga0501311_004430
314 Ga0501316_003478
315 Ga0501317_003829
316 Ga0501321_001430
317 Ga0501321_002355
318 Ga0501322_000648
319 Ga0501036_0006122
320 Ga0501036_0022196
321 Ga0501036_0026550
322 Ga0501037_0029796
323 Ga0501037_0061333
324 Ga0501038_0000986
325 Ga0501039_0076255
326 Ga0501040_0006704
327 Ga0501041_0024640
328 Ga0501042_0012330
329 Ga0501042_0196658
330 Ga0501046_0044895
331 Ga0501047_0013895
332 Ga0501048_0011025
333 Ga0501067_0081967
334 Ga0501068_0058331
335 Ga0501068_0123305
336 Ga0501069_0063216
337 Ga0501070_0001766
338 Ga0501070_0015466
339 Ga0501072_0094414
340 Ga0501073_0062472
341 Ga0501074_0009114
342 Ga0501075_0014401
343 Ga0501076_0006498
344 Ga0501080_0058672
345 Ga0501080_0109820
346 Ga0501081_0044258
347 Ga0501035_0008456
348 Ga0501035_0063030
349 Ga0501044_0005123
350 Ga0501044_0074824
351 Ga0501045_0182431
352 nmdc:mga03683_7638_c1
353 nmdc:mga03n38_5110_c1
354 nmdc:mga00v17_17669_c1
355 nmdc:mga00v17_7944_c1
356 nmdc:mga0yw44_111820_c1
357 nmdc:mga0yw44_24757_c1
358 nmdc:mga0yw44_3401_c1
359 nmdc:mga07m45_14283_c1
360 nmdc:mga07m45_5541_c1
361 nmdc:mga05p37_17900_c1
362 nmdc:mga06r32_25771_c1
363 Ga0500644_0000315
364 Ga0500556_0001592
365 Ga0500593_000520
366 Ga0500568_0007321
367 Ga0501082_0098068
368 Ga0466962_0005850
369 2643961479
370 2644032414
371 2644090748
372 2644102698
373 2644118360
374 2644320552
375 2738870587
376 2812334131
377 2816424502
378 2891972182
379 2915361625
380 8054473286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05698

Trigger_C

Bacterial trigger factor protein (TF) C-terminus

258

419

0.99

PF05697

Trigger_N

Bacterial trigger factor protein (TF)

1

145

0.98

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

155

221

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oxg-assembly1.cif.gz_A ttslyd fkbp domain with m8a pseudo-wild-type s2 peptide 0.7979 158 243
1p9y-assembly2.cif.gz_B ribosome binding of e. coli trigger factor mutant f44l. 0.7685 1 118
1p9y-assembly2.cif.gz_B ribosome binding of e. coli trigger factor mutant f44l. 0.7629 1 118
8g01-assembly1.cif.gz_C yes complex - e. coli mray, protein e id21, e. coli slyd 0.7577 158 239
2pbc-assembly4.cif.gz_D fk506-binding protein 2 0.7567 153 237
ID Description Score Start End Superfamily
af_P9WG55_151_243_1.10.3120.10 Mainly Alpha;Orthogonal Bundle;Trigger factor, domain 2;Trigger factor, C-terminal domain 1.003 151 243 1.10.3120.10
af_P9WG55_151_243_1.10.3120.10 Mainly Alpha;Orthogonal Bundle;Trigger factor, domain 2;Trigger factor, C-terminal domain 0.992 151 243 1.10.3120.10
af_P9WG55_1_115_3.30.70.1050 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Trigger factor ribosome-binding domain 0.9676 1 115 3.30.70.1050
af_P9WG55_1_115_3.30.70.1050 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Trigger factor ribosome-binding domain 0.9595 1 115 3.30.70.1050
af_Q2FXQ6_1_116_3.30.70.1050 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Trigger factor ribosome-binding domain 0.9186 1 115 3.30.70.1050
ID Description Score Start End GO Terms
AF-A0A7V9R0F3-F1-model_v4 Trigger factor (TF) (EC 5.2.1.8) (PPIase) 0.9521 1 445 GO:0005737
GO:0015031
GO:0043022
GO:0043335
GO:0044183
GO:0051083
GO:0051301
GO:0061077
GO:0140839
GO:0140840
AF-A0A6B0Q440-F1-model_v4 deleted 0.9462 1 106
AF-A0A353MLR6-F1-model_v4 deleted 0.9441 2 110
AF-A0A7V9R0F3-F1-model_v4 Trigger factor (TF) (EC 5.2.1.8) (PPIase) 0.9418 1 445 GO:0005737
GO:0015031
GO:0043022
GO:0043335
GO:0044183
GO:0051083
GO:0051301
GO:0061077
GO:0140839
GO:0140840
AF-A0A520W342-F1-model_v4 Trigger factor family protein 0.9378 1 85 GO:0003755
GO:0015031
GO:0043022
GO:0043335
GO:0044183
GO:0051083
GO:0051301
GO:0061077

Map