F292096

General Info

Members Datasets Scaffolds Average Seq Length
190 139 380 157

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100082772|Ga0070694_1000827725
Length 173
Sequence VIEIIQVPPDTPDALQLLSELDTQLLRLPYPDESRHAFSVEKLLRERVTFFVTRYDNAPAGCGGIKFYPDYAEVKRMYVRPSHRRLGLGKAMLDHLAEHARLQGIDVLRLETGIYQVEAIGLYERYGFQRRTPFSEYKVDPMSVYFEKVLHDLTGSVDSRSEDFHSRSEDLDS

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0.53
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 22.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100082772 3300005444 Unclassified 2235
2 JGI24034J26672_10000005 3300002239 Bacteria 404185
3 rootL2_10094486 3300003322 Bacteria 7418
4 Ga0065704_10118240 3300005289 Bacteria 1819
5 Ga0065707_10098650 3300005295 Bacteria 3069
6 Ga0065707_10125159 3300005295 Bacteria 2008
7 Ga0070676_10098926 3300005328 Unclassified 1799
8 Ga0068869_100038697 3300005334 Bacteria 3402
9 Ga0070680_100030112 3300005336 Bacteria 4359
10 Ga0068868_100024973 3300005338 Unclassified 4539
11 Ga0070687_100229214 3300005343 Bacteria 1142
12 Ga0070692_10437475 3300005345 Bacteria 834
13 Ga0070692_10528933 3300005345 Bacteria 769
14 Ga0070671_100001794 3300005355 Bacteria 16314
15 Ga0070673_100037418 3300005364 Bacteria 3697
16 Ga0070673_100302461 3300005364 Unclassified 1409
17 Ga0070688_101128040 3300005365 Unclassified 628
18 Ga0070701_10084896 3300005438 Bacteria 1723
19 Ga0070701_10420252 3300005438 Bacteria 851
20 Ga0070705_100309711 3300005440 Unclassified 1135
21 Ga0070700_100456059 3300005441 Unclassified 974
22 Ga0070694_100065267 3300005444 Bacteria 2493
23 Ga0070694_100100003 3300005444 Bacteria 2050
24 Ga0070708_100279688 3300005445 Bacteria 1571
25 Ga0068867_101613404 3300005459 Bacteria 606
26 Ga0070685_10004268 3300005466 Bacteria 7217
27 Ga0070706_100271231 3300005467 Bacteria 1583
28 Ga0070707_100211552 3300005468 Bacteria 1890
29 Ga0070697_100362004 3300005536 Bacteria 1254
30 Ga0070697_100587174 3300005536 Bacteria 978
31 Ga0070686_101323506 3300005544 Unclassified 602
32 Ga0070695_100157088 3300005545 Bacteria 1593
33 Ga0070696_100187478 3300005546 Bacteria 1538
34 Ga0070665_100000281 3300005548 Bacteria 83503
35 Ga0070704_100008829 3300005549 Bacteria 6066
36 Ga0070704_101138204 3300005549 Unclassified 710
37 Ga0068857_100425109 3300005577 Bacteria 1239
38 Ga0068854_100801902 3300005578 Unclassified 821
39 Ga0068859_100007347 3300005617 Bacteria 11178
40 Ga0068859_100234352 3300005617 Bacteria 1924
41 Ga0068859_100390143 3300005617 Bacteria 1488
42 Ga0068864_100186766 3300005618 Bacteria 1898
43 Ga0068861_100114542 3300005719 Bacteria 2165
44 Ga0068863_100150007 3300005841 Bacteria 2230
45 Ga0068863_100929378 3300005841 Unclassified 871
46 Ga0068863_102159767 3300005841 Bacteria 567
47 Ga0068858_100000026 3300005842 Bacteria 153013
48 Ga0068860_100278961 3300005843 Bacteria 1633
49 Ga0068860_101462354 3300005843 Unclassified 705
50 Ga0068862_100314158 3300005844 Bacteria 1445
51 Ga0081539_10011135 3300005985 Bacteria 7176
52 Ga0070717_10027912 3300006028 Bacteria 4513
53 Ga0070712_100032207 3300006175 Bacteria 3538
54 Ga0097621_100632919 3300006237 Bacteria 980
55 Ga0075428_100026172 3300006844 Bacteria 6461
56 Ga0075428_100280774 3300006844 Unclassified 1792
57 Ga0075431_100001919 3300006847 Bacteria 19764
58 Ga0075431_100262002 3300006847 Bacteria 1754
59 Ga0075433_10008821 3300006852 Bacteria 8045
60 Ga0075434_100372442 3300006871 Bacteria 1449
61 Ga0075434_100449998 3300006871 Bacteria 1309
62 Ga0075434_101256086 3300006871 Unclassified 752
63 Ga0075429_100080752 3300006880 Bacteria 2835
64 Ga0075436_100147274 3300006914 Bacteria 1656
65 Ga0097620_100007348 3300006931 Bacteria 11178
66 Ga0097620_100390116 3300006931 Bacteria 1488
67 Ga0111539_10007593 3300009094 Bacteria 13857
68 Ga0111539_10120466 3300009094 Bacteria 3074
69 Ga0105245_11575833 3300009098 Unclassified 708
70 Ga0105247_10000022 3300009101 Bacteria 219796
71 Ga0105247_10338094 3300009101 Unclassified 1055
72 Ga0114129_10067786 3300009147 Bacteria 4976
73 Ga0114129_10143471 3300009147 Unclassified 3272
74 Ga0114129_10236362 3300009147 Bacteria 2458
75 Ga0114129_10941165 3300009147 Bacteria 1092
76 Ga0114129_12541747 3300009147 Unclassified 612
77 Ga0105243_10001349 3300009148 Bacteria 21855
78 Ga0105243_10768411 3300009148 Unclassified 946
79 Ga0105243_11308805 3300009148 Bacteria 742
80 Ga0105243_12300927 3300009148 Unclassified 576
81 Ga0105241_11053555 3300009174 Bacteria 763
82 Ga0105242_10000431 3300009176 Bacteria 33417
83 Ga0105242_10004220 3300009176 Bacteria 11202
84 Ga0105248_11014713 3300009177 Bacteria 937
85 Ga0105248_12609383 3300009177 Unclassified 576
86 Ga0105249_10024668 3300009553 Bacteria 5405
87 Ga0105249_10386207 3300009553 Bacteria 1427
88 Ga0105239_10039807 3300010375 Bacteria 5150
89 Ga0105239_10914532 3300010375 Bacteria 1007
90 Ga0157378_10000011 3300013297 Bacteria 158889
91 Ga0157378_10032212 3300013297 Bacteria 4631
92 Ga0157378_10217884 3300013297 Bacteria 1813
93 Ga0157378_10267517 3300013297 Bacteria 1643
94 Ga0163162_10013873 3300013306 Bacteria 7873
95 Ga0163162_10098520 3300013306 Bacteria 3013
96 Ga0157375_10010274 3300013308 Bacteria 8238
97 Ga0157379_10216363 3300014968 Bacteria 1735
98 Ga0163161_10008832 3300017792 Bacteria 6967
99 Ga0163161_10273539 3300017792 Unclassified 1322
100 Ga0207672_1000027 3300025223 Bacteria 18614
101 Ga0207710_10000001 3300025900 Bacteria 1797433
102 Ga0207684_10048742 3300025910 Bacteria 3593
103 Ga0207693_10012863 3300025915 Bacteria 6752
104 Ga0207660_10017850 3300025917 Bacteria 4722
105 Ga0207662_10095434 3300025918 Bacteria 1836
106 Ga0207646_10309790 3300025922 Bacteria 1426
107 Ga0207681_10287655 3300025923 Bacteria 1296
108 Ga0207686_10000030 3300025934 Bacteria 159065
109 Ga0207686_10000757 3300025934 Bacteria 19867
110 Ga0207709_10001735 3300025935 Bacteria 14679
111 Ga0207711_10314885 3300025941 Bacteria 1445
112 Ga0207689_10051595 3300025942 Bacteria 3391
113 Ga0207661_10876012 3300025944 Unclassified 827
114 Ga0207651_10471940 3300025960 Unclassified 1080
115 Ga0207640_10785956 3300025981 Unclassified 823
116 Ga0207677_10070435 3300026023 Bacteria 2464
117 Ga0207677_10435378 3300026023 Unclassified 1120
118 Ga0207703_10000291 3300026035 Bacteria 55245
119 Ga0207703_11157672 3300026035 Unclassified 743
120 Ga0207641_10593802 3300026088 Bacteria 1083
121 Ga0207648_11264049 3300026089 Bacteria 693
122 Ga0207676_10081413 3300026095 Bacteria 2631
123 Ga0207674_10769524 3300026116 Bacteria 929
124 Ga0207675_100001228 3300026118 Bacteria 25571
125 Ga0209981_1030411 3300027378 Unclassified 791
126 Ga0207428_10017484 3300027907 Bacteria 6151
127 Ga0268266_10000161 3300028379 Bacteria 125387
128 Ga0307515_10168442 3300028794 Bacteria 2196
129 Ga0307414_11171371 3300032004 Bacteria 711
130 Ga0373955_0546184 3300035172 Unclassified 709
131 Ga0373927_1049700 3300035695 Bacteria 537
132 Ga0237816_00063 3300039145 Bacteria 7250
133 Ga0453683_0017009 3300044673 Bacteria 4687
134 Ga0453683_0304308 3300044673 Unclassified 1020
135 Ga0451576_0342562 3300045051 Unclassified 1565
136 Ga0451576_0487046 3300045051 Bacteria 1295
137 Ga0451576_1353711 3300045051 Unclassified 741
138 Ga0495653_0307457 3300046463 Bacteria 1032
139 Ga0495580_0280660 3300046472 Bacteria 1136
140 Ga0495639_0034122 3300046475 Bacteria 2275
141 Ga0495630_0006510 3300046517 Bacteria 8319
142 Ga0495665_0382093 3300046531 Bacteria 715
143 Ga0495635_0358219 3300046663 Bacteria 972
144 Ga0495658_0325194 3300046683 Unclassified 975
145 Ga0495624_0046908 3300046690 Bacteria 2746
146 Ga0495600_0107854 3300046809 Unclassified 1814
147 Ga0495581_0023350 3300047315 Bacteria 3584
148 Ga0495636_0166299 3300047318 Unclassified 995
149 Ga0495674_0014578 3300047319 Bacteria 7355
150 Ga0495676_0277616 3300047321 Bacteria 1135
151 Ga0495680_0299656 3300047322 Unclassified 1129
152 Ga0495684_0001419 3300047471 Bacteria 19209
153 Ga0495614_0112093 3300048089 Bacteria 1198
154 Ga0496106_0009284 3300048909 Bacteria 7270
155 Ga0501298_077389 3300049521 Bacteria 727
156 Ga0501036_0032098 3300049572 Bacteria 4437
157 Ga0501041_0217293 3300049577 Bacteria 1199
158 Ga0501046_0354405 3300049580 Bacteria 1065
159 Ga0501048_0071999 3300049582 Bacteria 2440
160 Ga0501071_0221373 3300049587 Bacteria 1424
161 Ga0501072_0044778 3300049588 Bacteria 3479
162 Ga0501075_0381095 3300049591 Unclassified 1075
163 Ga0501075_0490363 3300049591 Unclassified 937
164 Ga0501076_0159786 3300049592 Bacteria 1835
165 Ga0501235_121892 3300049669 Bacteria 653
166 Ga0501079_0211623 3300049741 Bacteria 1514
167 Ga0501080_0393604 3300049742 Bacteria 1247
168 Ga0501081_0189918 3300049743 Bacteria 1487
169 Ga0501083_0853065 3300049744 Bacteria 593
170 Ga0501035_0129143 3300049822 Bacteria 2204
171 Ga0501045_0010237 3300049824 Bacteria 6566
172 nmdc:mga05p37_160745_c1 3300050507 Bacteria 2744
173 nmdc:mga05p37_2006378_c1 3300050507 Unclassified 547
174 nmdc:mga05p37_39978_c1 3300050507 Bacteria 5759
175 nmdc:mga05p37_866096_c1 3300050507 Bacteria 979
176 nmdc:mga09592_1575693_c1 3300050508 Unclassified 532
177 nmdc:mga09592_849508_c1 3300050508 Bacteria 770
178 nmdc:mga06r32_189153_c1 3300050510 Bacteria 2046
179 nmdc:mga06r32_272310_c1 3300050510 Bacteria 1680
180 nmdc:mga08y16_6031_c1 3300050511 Bacteria 12703
181 nmdc:mga0n895_423135_c1 3300050512 Bacteria 1346
182 nmdc:mga0n895_630457_c1 3300050512 Bacteria 1072
183 nmdc:mga0n895_66590_c1 3300050512 Bacteria 3567
184 nmdc:mga08x19_1366569_c1 3300050514 Unclassified 501
185 nmdc:mga0a205_45443_c2 3300050515 Bacteria 2655
186 Ga0500556_0086642 3300053104 Unclassified 1191
187 Ga0501084_0084265 3300054114 Bacteria 2668
188 Ga0501084_0147652 3300054114 Unclassified 1981
189 Ga0501082_0005588 3300060353 Bacteria 10923
190 Ga0530510_0017605 3300061734 Bacteria 5064
191 Ga0070694_100082772
192 JGI24034J26672_10000005
193 rootL2_10094486
194 Ga0065704_10118240
195 Ga0065707_10098650
196 Ga0065707_10125159
197 Ga0070676_10098926
198 Ga0068869_100038697
199 Ga0070680_100030112
200 Ga0068868_100024973
201 Ga0070687_100229214
202 Ga0070692_10437475
203 Ga0070692_10528933
204 Ga0070671_100001794
205 Ga0070673_100037418
206 Ga0070673_100302461
207 Ga0070688_101128040
208 Ga0070701_10084896
209 Ga0070701_10420252
210 Ga0070705_100309711
211 Ga0070700_100456059
212 Ga0070694_100065267
213 Ga0070694_100100003
214 Ga0070708_100279688
215 Ga0068867_101613404
216 Ga0070685_10004268
217 Ga0070706_100271231
218 Ga0070707_100211552
219 Ga0070697_100362004
220 Ga0070697_100587174
221 Ga0070686_101323506
222 Ga0070695_100157088
223 Ga0070696_100187478
224 Ga0070665_100000281
225 Ga0070704_100008829
226 Ga0070704_101138204
227 Ga0068857_100425109
228 Ga0068854_100801902
229 Ga0068859_100007347
230 Ga0068859_100234352
231 Ga0068859_100390143
232 Ga0068864_100186766
233 Ga0068861_100114542
234 Ga0068863_100150007
235 Ga0068863_100929378
236 Ga0068863_102159767
237 Ga0068858_100000026
238 Ga0068860_100278961
239 Ga0068860_101462354
240 Ga0068862_100314158
241 Ga0081539_10011135
242 Ga0070717_10027912
243 Ga0070712_100032207
244 Ga0097621_100632919
245 Ga0075428_100026172
246 Ga0075428_100280774
247 Ga0075431_100001919
248 Ga0075431_100262002
249 Ga0075433_10008821
250 Ga0075434_100372442
251 Ga0075434_100449998
252 Ga0075434_101256086
253 Ga0075429_100080752
254 Ga0075436_100147274
255 Ga0097620_100007348
256 Ga0097620_100390116
257 Ga0111539_10007593
258 Ga0111539_10120466
259 Ga0105245_11575833
260 Ga0105247_10000022
261 Ga0105247_10338094
262 Ga0114129_10067786
263 Ga0114129_10143471
264 Ga0114129_10236362
265 Ga0114129_10941165
266 Ga0114129_12541747
267 Ga0105243_10001349
268 Ga0105243_10768411
269 Ga0105243_11308805
270 Ga0105243_12300927
271 Ga0105241_11053555
272 Ga0105242_10000431
273 Ga0105242_10004220
274 Ga0105248_11014713
275 Ga0105248_12609383
276 Ga0105249_10024668
277 Ga0105249_10386207
278 Ga0105239_10039807
279 Ga0105239_10914532
280 Ga0157378_10000011
281 Ga0157378_10032212
282 Ga0157378_10217884
283 Ga0157378_10267517
284 Ga0163162_10013873
285 Ga0163162_10098520
286 Ga0157375_10010274
287 Ga0157379_10216363
288 Ga0163161_10008832
289 Ga0163161_10273539
290 Ga0207672_1000027
291 Ga0207710_10000001
292 Ga0207684_10048742
293 Ga0207693_10012863
294 Ga0207660_10017850
295 Ga0207662_10095434
296 Ga0207646_10309790
297 Ga0207681_10287655
298 Ga0207686_10000030
299 Ga0207686_10000757
300 Ga0207709_10001735
301 Ga0207711_10314885
302 Ga0207689_10051595
303 Ga0207661_10876012
304 Ga0207651_10471940
305 Ga0207640_10785956
306 Ga0207677_10070435
307 Ga0207677_10435378
308 Ga0207703_10000291
309 Ga0207703_11157672
310 Ga0207641_10593802
311 Ga0207648_11264049
312 Ga0207676_10081413
313 Ga0207674_10769524
314 Ga0207675_100001228
315 Ga0209981_1030411
316 Ga0207428_10017484
317 Ga0268266_10000161
318 Ga0307515_10168442
319 Ga0307414_11171371
320 Ga0373955_0546184
321 Ga0373927_1049700
322 Ga0237816_00063
323 Ga0453683_0017009
324 Ga0453683_0304308
325 Ga0451576_0342562
326 Ga0451576_0487046
327 Ga0451576_1353711
328 Ga0495653_0307457
329 Ga0495580_0280660
330 Ga0495639_0034122
331 Ga0495630_0006510
332 Ga0495665_0382093
333 Ga0495635_0358219
334 Ga0495658_0325194
335 Ga0495624_0046908
336 Ga0495600_0107854
337 Ga0495581_0023350
338 Ga0495636_0166299
339 Ga0495674_0014578
340 Ga0495676_0277616
341 Ga0495680_0299656
342 Ga0495684_0001419
343 Ga0495614_0112093
344 Ga0496106_0009284
345 Ga0501298_077389
346 Ga0501036_0032098
347 Ga0501041_0217293
348 Ga0501046_0354405
349 Ga0501048_0071999
350 Ga0501071_0221373
351 Ga0501072_0044778
352 Ga0501075_0381095
353 Ga0501075_0490363
354 Ga0501076_0159786
355 Ga0501235_121892
356 Ga0501079_0211623
357 Ga0501080_0393604
358 Ga0501081_0189918
359 Ga0501083_0853065
360 Ga0501035_0129143
361 Ga0501045_0010237
362 nmdc:mga05p37_160745_c1
363 nmdc:mga05p37_2006378_c1
364 nmdc:mga05p37_39978_c1
365 nmdc:mga05p37_866096_c1
366 nmdc:mga09592_1575693_c1
367 nmdc:mga09592_849508_c1
368 nmdc:mga06r32_189153_c1
369 nmdc:mga06r32_272310_c1
370 nmdc:mga08y16_6031_c1
371 nmdc:mga0n895_423135_c1
372 nmdc:mga0n895_630457_c1
373 nmdc:mga0n895_66590_c1
374 nmdc:mga08x19_1366569_c1
375 nmdc:mga0a205_45443_c2
376 Ga0500556_0086642
377 Ga0501084_0084265
378 Ga0501084_0147652
379 Ga0501082_0005588
380 Ga0530510_0017605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

48

139

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

15

128

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

31

140

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

46

130

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8943 3 154
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8825 51 152
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8825 3 154
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.881 51 152
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8809 51 154
ID Description Score Start End Superfamily
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8943 3 154 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8825 3 154 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8709 55 135 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8651 57 106 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8585 51 154 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0P9DGE9-F1-model_v4 GNAT family acetyltransferase 0.9803 4 154 GO:0016747
AF-A0A559Q628-F1-model_v4 deleted 0.9797 4 153
AF-A0A511R3I7-F1-model_v4 N-acetyltransferase 0.9771 4 152 GO:0016747
AF-A0A2V5WW03-F1-model_v4 N-acetyltransferase 0.9752 5 154 GO:0016747
AF-A0A523MF39-F1-model_v4 GNAT family N-acetyltransferase 0.9752 4 154 GO:0016747

Map