F291861

General Info

Members Datasets Scaffolds Average Seq Length
190 150 380 192

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10020177|JGI25407J50210_100201771
Length 216
Sequence MRYYSTQVWPLTKTDRTEEESRVRKLTYFIAASIDGFIGAPDGEAEFFTRFVDEEFFEFLKAEYPETLPTHGRQALGLDDLENKRFDTVIQGRASYDLALAAKITSPYAHLRQYVASRTIEDAPDPAVEIVADDVVGKVRELKRDEGLDIYLCGGSTLAGALLDEIDELVIKTYPVVLGSGMPMFASGFHITDFTLESVRAFGNGALVRWYGRTRP

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
44 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
47 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
48 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
75 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
76 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
77 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
89 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
93 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
94 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
95 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
96 2643221548 Streptomyces sp. Root55 Isolate Unclassified
97 2643221578 Streptomyces sp. Root63 Isolate Unclassified
98 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
99 2643221670 Streptomyces sp. Root431 Isolate Unclassified
100 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
101 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
102 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
103 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
104 2643221692 Nocardia sp. Root136 Isolate Unclassified
105 2643221714 Streptomyces sp. Root264 Isolate Unclassified
106 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
107 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
108 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
109 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
110 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
111 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
112 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
113 2808606448 Streptomyces sp. 193411 Isolate Unclassified
114 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
115 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
116 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
117 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
118 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
119 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
120 2862574272 Streptomyces sp. AcE210 Isolate Nodule
121 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
122 2867428634 Streptomyces sp. RP5T Isolate Unclassified
123 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
124 2891562705 Microbispora tritici MT50 Isolate Unclassified
125 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
126 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
127 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
128 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
129 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
130 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
131 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
132 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
133 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
134 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
135 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
136 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
137 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
138 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
139 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
140 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
141 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
142 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
143 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
144 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
145 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
146 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
147 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
148 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
149 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
150 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.32
Metatranscriptomes 0.53
Isolates 33.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 2.11
Rhizoplane 1.05
Rhizosphere 70.53
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10020177 3300003373 Bacteria 1734
2 rootH2_10215383 3300003320 Bacteria 1091
3 rootH1_10074544 3300003323 Bacteria 2483
4 JGI25407J50210_10004768 3300003373 Bacteria 3311
5 Ga0006562J51391_1182584 3300003578 Bacteria 2855
6 Ga0070682_100708534 3300005337 Bacteria 808
7 Ga0070714_100038461 3300005435 Bacteria 4022
8 Ga0070678_100481417 3300005456 Bacteria 1092
9 Ga0068870_10147048 3300005840 Bacteria 1384
10 Ga0081538_10000356 3300005981 Bacteria 52018
11 Ga0081538_10000861 3300005981 Bacteria 32719
12 Ga0081538_10005478 3300005981 Bacteria 11403
13 Ga0081538_10083072 3300005981 Bacteria 1695
14 Ga0075365_10052037 3300006038 Bacteria 2707
15 Ga0075363_100049731 3300006048 Bacteria 2233
16 Ga0075363_100106672 3300006048 Bacteria 1554
17 Ga0075428_100002034 3300006844 Bacteria 21796
18 Ga0075428_100005123 3300006844 Bacteria 14564
19 Ga0075430_100001516 3300006846 Bacteria 18950
20 Ga0075430_100014563 3300006846 Bacteria 6699
21 Ga0075431_100002814 3300006847 Bacteria 16835
22 Ga0075431_100006037 3300006847 Bacteria 12011
23 Ga0075431_100011918 3300006847 Bacteria 8772
24 Ga0075434_100487857 3300006871 Bacteria 1253
25 Ga0075429_100003015 3300006880 Bacteria 14277
26 Ga0068865_100451192 3300006881 Bacteria 1063
27 Ga0099826_10163785 3300006948 Bacteria 1257
28 Ga0111539_10045399 3300009094 Bacteria 5260
29 Ga0114129_10005409 3300009147 Bacteria 18033
30 Ga0114129_10058882 3300009147 Bacteria 5372
31 Ga0157375_11836961 3300013308 Bacteria 719
32 Ga0183367_1002 3300015688 Bacteria 1101531
33 Ga0207426_1035577 3300025302 Bacteria 1588
34 Ga0207709_10244864 3300025935 Bacteria 1306
35 Ga0207709_10291181 3300025935 Bacteria 1210
36 Ga0207683_10574257 3300026121 Bacteria 1043
37 Ga0207428_10020815 3300027907 Bacteria 5563
38 Ga0307515_10060132 3300028794 Bacteria 5429
39 Ga0307511_10216302 3300030521 Bacteria 970
40 Ga0307512_10070429 3300030522 Bacteria 2604
41 Ga0307513_10023119 3300031456 Bacteria 7274
42 Ga0307513_10031524 3300031456 Bacteria 6001
43 Ga0307508_10008187 3300031616 Bacteria 9692
44 Ga0307508_10024287 3300031616 Bacteria 5501
45 Ga0307514_10030004 3300031649 Bacteria 4366
46 Ga0307514_10243737 3300031649 Bacteria 1073
47 Ga0307413_10182242 3300031824 Bacteria 1499
48 Ga0307406_10122711 3300031901 Bacteria 1809
49 Ga0307412_10128357 3300031911 Bacteria 1838
50 Ga0307416_100070847 3300032002 Bacteria 2893
51 Ga0307416_101277912 3300032002 Bacteria 840
52 Ga0307411_10469782 3300032005 Bacteria 1057
53 Ga0307415_100044039 3300032126 Bacteria 2981
54 Ga0395899_0437474 3300037312 Bacteria 859
55 Ga0395898_0003329 3300037466 Bacteria 18046
56 Ga0395898_0484726 3300037466 Bacteria 1176
57 Ga0395901_0048379 3300038443 Bacteria 4416
58 Ga0395901_0218260 3300038443 Bacteria 1994
59 Ga0439436_0013956 3300041404 Bacteria 2427
60 Ga0451791_0122353 3300041451 Unclassified 1090
61 Ga0451837_1654448 3300041494 Unclassified 837
62 Ga0451853_0079623 3300041512 Bacteria 2373
63 Ga0451853_0165330 3300041512 Bacteria 1039
64 Ga0451853_0512021 3300041512 Bacteria 8812
65 Ga0451853_1373222 3300041512 Bacteria 2469
66 Ga0439450_069815 3300042008 Bacteria 861
67 Ga0439457_000032 3300042014 Bacteria 28723
68 Ga0439457_040083 3300042014 Bacteria 1044
69 Ga0450898_006171 3300042134 Bacteria 1834
70 Ga0439458_0019962 3300042157 Bacteria 1545
71 Ga0466972_0010894 3300044658 Bacteria 4562
72 Ga0466972_0078281 3300044658 Bacteria 1575
73 Ga0466966_0220420 3300044684 Bacteria 1145
74 Ga0466961_0086589 3300044693 Bacteria 1980
75 Ga0466970_0009715 3300044765 Bacteria 4867
76 Ga0466970_0132835 3300044765 Bacteria 1368
77 Ga0466960_0002701 3300044901 Bacteria 6704
78 Ga0466960_0284821 3300044901 Bacteria 927
79 Ga0466958_0462610 3300045836 Bacteria 822
80 Ga0466967_1054386 3300045976 Bacteria 810
81 Ga0495603_0143889 3300046455 Bacteria 1386
82 Ga0495629_0005303 3300046459 Bacteria 9637
83 Ga0495629_0218029 3300046459 Bacteria 1317
84 Ga0495638_0342387 3300046460 Bacteria 792
85 Ga0495585_0068196 3300046492 Bacteria 1944
86 Ga0495594_0000431 3300046499 Bacteria 21108
87 Ga0495620_0072334 3300046515 Bacteria 1408
88 Ga0495643_0227030 3300046522 Bacteria 882
89 Ga0495622_0003921 3300046557 Bacteria 6950
90 Ga0495668_0272175 3300046616 Bacteria 928
91 Ga0495611_0052899 3300046648 Bacteria 1832
92 Ga0495625_0039496 3300046660 Bacteria 3446
93 Ga0495625_0389398 3300046660 Bacteria 873
94 Ga0495661_0336156 3300046665 Bacteria 747
95 Ga0495588_0058094 3300046674 Bacteria 1999
96 Ga0495588_0170828 3300046674 Bacteria 1149
97 Ga0495670_0330955 3300046691 Bacteria 818
98 Ga0495589_0018336 3300046794 Bacteria 3589
99 Ga0495589_0137467 3300046794 Bacteria 1171
100 Ga0495589_0299071 3300046794 Bacteria 746
101 Ga0495636_0003680 3300047318 Bacteria 5960
102 Ga0495636_0012968 3300047318 Bacteria 3304
103 Ga0495676_0002124 3300047321 Bacteria 17506
104 Ga0495683_0047871 3300047323 Bacteria 2145
105 Ga0495683_0154194 3300047323 Bacteria 1067
106 Ga0495687_003433 3300047443 Bacteria 11495
107 Ga0495677_0185726 3300047445 Bacteria 806
108 Ga0495685_000375 3300047447 Bacteria 14218
109 Ga0495685_004600 3300047447 Bacteria 4471
110 Ga0495686_0021794 3300047472 Bacteria 4249
111 Ga0496114_0415080 3300048917 Bacteria 1192
112 Ga0501038_0000885 3300049574 Bacteria 26550
113 Ga0501043_0145973 3300049579 Bacteria 1852
114 Ga0501047_0011977 3300049581 Bacteria 8207
115 Ga0501035_0022093 3300049822 Bacteria 5844
116 Ga0501044_0031004 3300049823 Bacteria 5629
117 nmdc:mga03n38_57651_c1 3300050490 Bacteria 1757
118 nmdc:mga07m45_185817_c1 3300050496 Bacteria 1208
119 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
120 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
121 nmdc:mga09592_31527_c1 3300050508 Bacteria 4418
122 nmdc:mga0qj67_5082_c1 3300050509 Bacteria 9573
123 nmdc:mga0qj67_619659_c1 3300050509 Bacteria 865
124 nmdc:mga06r32_2152_c1 3300050510 Bacteria 17619
125 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
126 nmdc:mga06r32_657_c1 3300050510 Bacteria 30190
127 nmdc:mga08y16_32537_c1 3300050511 Bacteria 5481
128 2515851281 2515154155 Bacteria 7985436
129 2552105127 2551306166 Bacteria 9731570
130 2552105128 2551306166 Bacteria 9731570
131 2552109564 2551306166 Bacteria 9731570
132 2585298481 2582581312 Bacteria 7308206
133 2616902097 2616644941 Bacteria 8510691
134 2643763137 2643221548 Bacteria 8053412
135 2643900149 2643221578 Bacteria 9213798
136 2643943778 2643221587 Bacteria 7586415
137 2644386784 2643221670 Bacteria 6497041
138 2644405627 2643221673 Bacteria 9196637
139 2644434516 2643221677 Bacteria 7584031
140 2644439912 2643221678 Bacteria 9540101
141 2644463993 2643221682 Bacteria 6743283
142 2644513050 2643221692 Bacteria 7282860
143 2644632757 2643221714 Bacteria 9015452
144 2744953908 2744054611 Bacteria 5611514
145 2784590298 2784132148 Bacteria 8627943
146 2785341317 2784746763 Bacteria 9783172
147 2785371367 2784746768 Bacteria 10036182
148 2791916202 2791354901 Bacteria 8322202
149 2808843919 2808606359 Bacteria 9866990
150 2808913477 2808606375 Bacteria 9466072
151 2809233972 2808606448 Bacteria 8656184
152 2812478875 2811994917 Bacteria 7761064
153 2819697306 2818991463 Bacteria 7948711
154 2852640895 2852635781 Bacteria 8251373
155 2856742290 2856741275 Bacteria 8096094
156 2862284872 2862281513 Bacteria 9621493
157 2862383641 2862382967 Bacteria 10317375
158 2862577632 2862574272 Bacteria 10567477
159 2863408494 2863404153 Bacteria 9672205
160 2867431464 2867428634 Bacteria 9590268
161 2875395179 2875391855 Bacteria 7600475
162 2891565434 2891562705 Bacteria 8039471
163 2912717832 2912715099 Bacteria 9460473
164 2919471602 2919468124 Bacteria 9133025
165 2919715921 2919713450 Bacteria 7431245
166 2919718196 2919713450 Bacteria 7431245
167 2929224966 2929219909 Bacteria 6984360
168 2946049484 2946045630 Bacteria 8527308
169 2946077629 2946072368 Bacteria 8999607
170 2947227050 2947224130 Bacteria 9938529
171 2947227777 2947224130 Bacteria 9938529
172 2954005346 2954002825 Bacteria 9173742
173 2954384119 2954380949 Bacteria 10050426
174 2954694938 2954691527 Bacteria 10720516
175 2954710115 2954701450 Bacteria 10834262
176 2954714434 2954711539 Bacteria 10867210
177 2954724380 2954721474 Bacteria 10456478
178 2954737438 2954731030 Bacteria 10243860
179 2954743302 2954740390 Bacteria 10229294
180 2954756292 2954749733 Bacteria 10366972
181 2954762259 2954759201 Bacteria 9358192
182 2990064026 2990059506 Bacteria 9321252
183 2990092941 2990088156 Bacteria 6657676
184 3006498145 3006493962 Bacteria 8825450
185 8003322292 8003314358 Bacteria 10575343
186 8008562664 8008558824 Bacteria 10610750
187 8023627916 8023623736 Bacteria 8593882
188 8056060934 8056060235 Bacteria 7259403
189 8056447617 8056447290 Bacteria 7680491
190 8056671726 8056667051 Bacteria 6953971
191 JGI25407J50210_10020177
192 rootH2_10215383
193 rootH1_10074544
194 JGI25407J50210_10004768
195 Ga0006562J51391_1182584
196 Ga0070682_100708534
197 Ga0070714_100038461
198 Ga0070678_100481417
199 Ga0068870_10147048
200 Ga0081538_10000356
201 Ga0081538_10000861
202 Ga0081538_10005478
203 Ga0081538_10083072
204 Ga0075365_10052037
205 Ga0075363_100049731
206 Ga0075363_100106672
207 Ga0075428_100002034
208 Ga0075428_100005123
209 Ga0075430_100001516
210 Ga0075430_100014563
211 Ga0075431_100002814
212 Ga0075431_100006037
213 Ga0075431_100011918
214 Ga0075434_100487857
215 Ga0075429_100003015
216 Ga0068865_100451192
217 Ga0099826_10163785
218 Ga0111539_10045399
219 Ga0114129_10005409
220 Ga0114129_10058882
221 Ga0157375_11836961
222 Ga0183367_1002
223 Ga0207426_1035577
224 Ga0207709_10244864
225 Ga0207709_10291181
226 Ga0207683_10574257
227 Ga0207428_10020815
228 Ga0307515_10060132
229 Ga0307511_10216302
230 Ga0307512_10070429
231 Ga0307513_10023119
232 Ga0307513_10031524
233 Ga0307508_10008187
234 Ga0307508_10024287
235 Ga0307514_10030004
236 Ga0307514_10243737
237 Ga0307413_10182242
238 Ga0307406_10122711
239 Ga0307412_10128357
240 Ga0307416_100070847
241 Ga0307416_101277912
242 Ga0307411_10469782
243 Ga0307415_100044039
244 Ga0395899_0437474
245 Ga0395898_0003329
246 Ga0395898_0484726
247 Ga0395901_0048379
248 Ga0395901_0218260
249 Ga0439436_0013956
250 Ga0451791_0122353
251 Ga0451837_1654448
252 Ga0451853_0079623
253 Ga0451853_0165330
254 Ga0451853_0512021
255 Ga0451853_1373222
256 Ga0439450_069815
257 Ga0439457_000032
258 Ga0439457_040083
259 Ga0450898_006171
260 Ga0439458_0019962
261 Ga0466972_0010894
262 Ga0466972_0078281
263 Ga0466966_0220420
264 Ga0466961_0086589
265 Ga0466970_0009715
266 Ga0466970_0132835
267 Ga0466960_0002701
268 Ga0466960_0284821
269 Ga0466958_0462610
270 Ga0466967_1054386
271 Ga0495603_0143889
272 Ga0495629_0005303
273 Ga0495629_0218029
274 Ga0495638_0342387
275 Ga0495585_0068196
276 Ga0495594_0000431
277 Ga0495620_0072334
278 Ga0495643_0227030
279 Ga0495622_0003921
280 Ga0495668_0272175
281 Ga0495611_0052899
282 Ga0495625_0039496
283 Ga0495625_0389398
284 Ga0495661_0336156
285 Ga0495588_0058094
286 Ga0495588_0170828
287 Ga0495670_0330955
288 Ga0495589_0018336
289 Ga0495589_0137467
290 Ga0495589_0299071
291 Ga0495636_0003680
292 Ga0495636_0012968
293 Ga0495676_0002124
294 Ga0495683_0047871
295 Ga0495683_0154194
296 Ga0495687_003433
297 Ga0495677_0185726
298 Ga0495685_000375
299 Ga0495685_004600
300 Ga0495686_0021794
301 Ga0496114_0415080
302 Ga0501038_0000885
303 Ga0501043_0145973
304 Ga0501047_0011977
305 Ga0501035_0022093
306 Ga0501044_0031004
307 nmdc:mga03n38_57651_c1
308 nmdc:mga07m45_185817_c1
309 nmdc:mga05p37_5508_c1
310 nmdc:mga09592_20965_c1
311 nmdc:mga09592_31527_c1
312 nmdc:mga0qj67_5082_c1
313 nmdc:mga0qj67_619659_c1
314 nmdc:mga06r32_2152_c1
315 nmdc:mga06r32_2991_c1
316 nmdc:mga06r32_657_c1
317 nmdc:mga08y16_32537_c1
318 2515851281
319 2552105127
320 2552105128
321 2552109564
322 2585298481
323 2616902097
324 2643763137
325 2643900149
326 2643943778
327 2644386784
328 2644405627
329 2644434516
330 2644439912
331 2644463993
332 2644513050
333 2644632757
334 2744953908
335 2784590298
336 2785341317
337 2785371367
338 2791916202
339 2808843919
340 2808913477
341 2809233972
342 2812478875
343 2819697306
344 2852640895
345 2856742290
346 2862284872
347 2862383641
348 2862577632
349 2863408494
350 2867431464
351 2875395179
352 2891565434
353 2912717832
354 2919471602
355 2919715921
356 2919718196
357 2929224966
358 2946049484
359 2946077629
360 2947227050
361 2947227777
362 2954005346
363 2954384119
364 2954694938
365 2954710115
366 2954714434
367 2954724380
368 2954737438
369 2954743302
370 2954756292
371 2954762259
372 2990064026
373 2990092941
374 3006498145
375 8003322292
376 8008562664
377 8023627916
378 8056060934
379 8056447617
380 8056671726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

24

208

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8372 1 193
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8327 1 193
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8099 1 193
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8063 1 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8057 1 193
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8257 1 193 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8212 1 193 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7846 3 194 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7803 3 192 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7734 4 192 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2Z5JF89-F1-model_v4 Deaminase 0.9932 1 194 GO:0008703
GO:0009231
AF-A0A0N0S6M7-F1-model_v4 deleted 0.9916 1 194
AF-A0A3N6JBC5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9904 1 194 GO:0008703
GO:0009231
AF-A0A7L4Y7P6-F1-model_v4 Dihydrofolate reductase 0.9898 1 194 GO:0008703
GO:0009231
AF-A0A1D3DQ47-F1-model_v4 Deaminase 0.9876 1 194 GO:0008703
GO:0009231

Map