F291242

General Info

Members Datasets Scaffolds Average Seq Length
189 106 378 203

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0091270|Ga0373947_0091270_592_1332
Length 246
Sequence VGNTDGRRRPRALNGERAADQPAQPAVPRSVPAPLAAARSRNNACVTKREPAISVVPANEASWEELQTIFGARGAATRCQCQRYKLAPRESFGSFPAEERAHRLRQQTDCGHPGSGTTSGLVAYLNGEPVGWCAVEPRSAYAGLLRNNRVSWEGRAEDKTDDSVWAVTCLFTRAGFRKRGISRALARAAVDFACSCGARAIEGYPMTTKNVILDELHVGTQGVFADAGFTEVSRPTLRRVVMRIDF

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
30 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
31 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
32 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
37 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
38 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
39 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
40 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
41 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
42 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
43 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
44 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
49 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
53 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
54 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
55 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
56 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
57 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
58 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
59 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
62 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
63 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
64 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
67 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.76
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0091270 3300035725 Bacteria 1900
2 Ga0070671_100764331 3300005355 Bacteria 840
3 Ga0070659_100205264 3300005366 Bacteria 1623
4 Ga0070711_100336401 3300005439 Bacteria 1210
5 Ga0070699_100325940 3300005518 Bacteria 1381
6 Ga0070684_100619514 3300005535 Bacteria 1007
7 Ga0068853_100570581 3300005539 Bacteria 1073
8 Ga0070686_100751345 3300005544 Bacteria 782
9 Ga0068861_100114478 3300005719 Bacteria 2166
10 Ga0068870_10162490 3300005840 Bacteria 1326
11 Ga0081455_10002019 3300005937 Bacteria 24270
12 Ga0081455_10081634 3300005937 Bacteria 2647
13 Ga0081455_10104926 3300005937 Bacteria 2260
14 Ga0081538_10013472 3300005981 Bacteria 6468
15 Ga0081540_1209951 3300005983 Bacteria 701
16 Ga0075430_100086957 3300006846 Bacteria 2616
17 Ga0075431_100000036 3300006847 Bacteria 68411
18 Ga0068865_100364542 3300006881 Bacteria 1174
19 Ga0111539_10379787 3300009094 Bacteria 1645
20 Ga0105245_10324456 3300009098 Bacteria 1518
21 Ga0105245_10483381 3300009098 Bacteria 1252
22 Ga0114129_10775081 3300009147 Bacteria 1226
23 Ga0105243_10416423 3300009148 Bacteria 1252
24 Ga0105246_10028046 3300011119 Bacteria 3696
25 Ga0163163_10067715 3300014325 Bacteria 3551
26 Ga0163163_11032200 3300014325 Bacteria 885
27 Ga0157380_10413573 3300014326 Unclassified 1284
28 Ga0182008_10171586 3300014497 Bacteria 1095
29 Ga0207643_10040311 3300025908 Bacteria 2629
30 Ga0207709_10352157 3300025935 Bacteria 1112
31 Ga0207708_10182957 3300026075 Bacteria 1664
32 Ga0207675_100173561 3300026118 Bacteria 2061
33 Ga0307416_100456885 3300032002 Bacteria 1331
34 Ga0307415_100776274 3300032126 Bacteria 872
35 Ga0373935_0076920 3300035692 Bacteria 2162
36 Ga0373925_0586846 3300037068 Bacteria 917
37 Ga0395900_0856089 3300037418 Bacteria 834
38 Ga0395898_0134840 3300037466 Bacteria 2364
39 Ga0395898_0477495 3300037466 Bacteria 1186
40 Ga0395901_0082099 3300038443 Bacteria 3367
41 Ga0395901_0136536 3300038443 Bacteria 2577
42 Ga0242420_070709 3300038996 Bacteria 709
43 Ga0451837_0904574 3300041494 Bacteria 1319
44 Ga0439448_0021759 3300042005 Bacteria 1989
45 Ga0439450_007433 3300042008 Bacteria 2007
46 Ga0439463_000164 3300042016 Bacteria 17224
47 Ga0439460_0039857 3300042461 Bacteria 1374
48 Ga0439440_0023796 3300042993 Bacteria 1399
49 Ga0466963_0038202 3300044694 Bacteria 3138
50 Ga0466964_0043349 3300044706 Bacteria 1825
51 Ga0466957_0010483 3300044842 Bacteria 5327
52 Ga0466960_0024190 3300044901 Bacteria 2738
53 Ga0466967_0190433 3300045976 Bacteria 1938
54 Ga0466967_0260668 3300045976 Bacteria 1658
55 Ga0466967_1145462 3300045976 Bacteria 775
56 Ga0495603_0096816 3300046455 Bacteria 1724
57 Ga0495653_0166778 3300046463 Bacteria 1524
58 Ga0495582_0053864 3300046473 Bacteria 2219
59 Ga0495608_0369488 3300046511 Bacteria 881
60 Ga0495665_0144396 3300046531 Bacteria 1243
61 Ga0495640_0201845 3300046533 Bacteria 1260
62 Ga0495586_0130982 3300046535 Bacteria 1404
63 Ga0495634_0038049 3300046642 Bacteria 3281
64 Ga0495658_0039632 3300046683 Bacteria 2615
65 Ga0495676_0123606 3300047321 Bacteria 1879
66 Ga0496100_0014051 3300048903 Bacteria 4639
67 Ga0496100_0382877 3300048903 Bacteria 1068
68 Ga0496101_0001556 3300048904 Bacteria 13764
69 Ga0496101_0009763 3300048904 Bacteria 6319
70 Ga0496101_0034182 3300048904 Bacteria 3589
71 Ga0496102_0028125 3300048905 Bacteria 5024
72 Ga0496102_0147906 3300048905 Bacteria 2206
73 Ga0496102_0179867 3300048905 Bacteria 1992
74 Ga0496104_0540755 3300048907 Bacteria 1076
75 Ga0496104_0845730 3300048907 Bacteria 820
76 Ga0496106_0009834 3300048909 Bacteria 7063
77 Ga0496106_0058659 3300048909 Bacteria 2914
78 Ga0496107_0006440 3300048910 Bacteria 8077
79 Ga0496107_0032007 3300048910 Bacteria 3757
80 Ga0496108_0015388 3300048911 Bacteria 6240
81 Ga0496109_0019694 3300048912 Bacteria 5953
82 Ga0496109_0426789 3300048912 Bacteria 1252
83 Ga0496109_0871341 3300048912 Bacteria 838
84 Ga0496110_0032739 3300048913 Bacteria 4493
85 Ga0496112_0019935 3300048915 Bacteria 6346
86 Ga0496112_0415249 3300048915 Bacteria 1285
87 Ga0496113_0035832 3300048916 Bacteria 3631
88 Ga0496114_0059002 3300048917 Bacteria 3205
89 Ga0496114_0088714 3300048917 Bacteria 2623
90 Ga0496115_0040126 3300048918 Bacteria 3720
91 Ga0496115_0192112 3300048918 Bacteria 1687
92 Ga0501031_0009262 3300049568 Bacteria 6397
93 Ga0501031_0127471 3300049568 Bacteria 1663
94 Ga0501032_0186699 3300049569 Bacteria 1356
95 Ga0501033_0023459 3300049570 Bacteria 4653
96 Ga0501036_0002212 3300049572 Bacteria 15209
97 Ga0501036_0010340 3300049572 Bacteria 7701
98 Ga0501036_0048739 3300049572 Bacteria 3586
99 Ga0501036_0101755 3300049572 Bacteria 2431
100 Ga0501036_0370492 3300049572 Bacteria 1195
101 Ga0501037_0212083 3300049573 Bacteria 1365
102 Ga0501038_0011626 3300049574 Bacteria 8031
103 Ga0501038_0081965 3300049574 Bacteria 2717
104 Ga0501039_0000806 3300049575 Bacteria 22593
105 Ga0501039_0022513 3300049575 Bacteria 4837
106 Ga0501039_0246660 3300049575 Bacteria 1404
107 Ga0501039_0383072 3300049575 Bacteria 1105
108 Ga0501039_0451739 3300049575 Bacteria 1009
109 Ga0501040_0006578 3300049576 Bacteria 7542
110 Ga0501040_0056785 3300049576 Bacteria 2686
111 Ga0501040_0303874 3300049576 Bacteria 1140
112 Ga0501041_0005039 3300049577 Bacteria 7692
113 Ga0501041_0009967 3300049577 Bacteria 5598
114 Ga0501041_0013658 3300049577 Bacteria 4817
115 Ga0501041_0200820 3300049577 Bacteria 1250
116 Ga0501041_0402992 3300049577 Bacteria 866
117 Ga0501042_0000319 3300049578 Bacteria 24154
118 Ga0501042_0010758 3300049578 Bacteria 6152
119 Ga0501042_0013293 3300049578 Bacteria 5600
120 Ga0501043_0094725 3300049579 Bacteria 2347
121 Ga0501043_0282158 3300049579 Bacteria 1273
122 Ga0501043_0544517 3300049579 Bacteria 863
123 Ga0501043_0635574 3300049579 Bacteria 785
124 Ga0501046_0012256 3300049580 Bacteria 7307
125 Ga0501046_0017236 3300049580 Bacteria 6034
126 Ga0501048_0281411 3300049582 Bacteria 1183
127 Ga0501048_0319891 3300049582 Bacteria 1105
128 Ga0501067_0000059 3300049583 Bacteria 64025
129 Ga0501067_0117978 3300049583 Bacteria 1476
130 Ga0501067_0395398 3300049583 Bacteria 771
131 Ga0501068_0003611 3300049584 Bacteria 8363
132 Ga0501068_0110121 3300049584 Bacteria 1712
133 Ga0501068_0114185 3300049584 Bacteria 1681
134 Ga0501068_0302408 3300049584 Bacteria 1024
135 Ga0501069_0000872 3300049585 Bacteria 14359
136 Ga0501069_0172965 3300049585 Bacteria 1246
137 Ga0501069_0249998 3300049585 Bacteria 1034
138 Ga0501070_0035612 3300049586 Bacteria 4159
139 Ga0501070_0077764 3300049586 Bacteria 2746
140 Ga0501071_0001155 3300049587 Bacteria 14787
141 Ga0501071_0098530 3300049587 Bacteria 2153
142 Ga0501072_0019104 3300049588 Bacteria 5293
143 Ga0501072_0034018 3300049588 Bacteria 3993
144 Ga0501072_0038410 3300049588 Bacteria 3757
145 Ga0501072_0049740 3300049588 Bacteria 3300
146 Ga0501072_0159762 3300049588 Bacteria 1798
147 Ga0501072_0798036 3300049588 Bacteria 739
148 Ga0501073_0151924 3300049589 Bacteria 1605
149 Ga0501074_0004036 3300049590 Bacteria 10471
150 Ga0501074_0026749 3300049590 Bacteria 4183
151 Ga0501075_0000115 3300049591 Bacteria 38676
152 Ga0501075_0009221 3300049591 Bacteria 6898
153 Ga0501075_0103376 3300049591 Bacteria 2165
154 Ga0501076_0001673 3300049592 Bacteria 14988
155 Ga0501076_0005968 3300049592 Bacteria 8793
156 Ga0501076_0009491 3300049592 Bacteria 7189
157 Ga0501076_0074956 3300049592 Bacteria 2711
158 Ga0501077_0016777 3300049593 Bacteria 4618
159 Ga0501077_0043891 3300049593 Bacteria 2841
160 Ga0501077_0080521 3300049593 Bacteria 2063
161 Ga0501077_0770669 3300049593 Bacteria 618
162 Ga0501079_0018607 3300049741 Bacteria 5307
163 Ga0501079_0028064 3300049741 Bacteria 4318
164 Ga0501079_0089647 3300049741 Bacteria 2382
165 Ga0501079_0158290 3300049741 Bacteria 1765
166 Ga0501080_0063556 3300049742 Bacteria 3435
167 Ga0501080_0096281 3300049742 Bacteria 2748
168 Ga0501081_0014187 3300049743 Bacteria 5253
169 Ga0501081_0045400 3300049743 Bacteria 3017
170 Ga0501081_0066945 3300049743 Bacteria 2498
171 Ga0501081_0348523 3300049743 Bacteria 1091
172 Ga0501083_0387236 3300049744 Bacteria 909
173 Ga0501035_0164249 3300049822 Bacteria 1921
174 Ga0501035_0497957 3300049822 Bacteria 1003
175 Ga0501035_0788058 3300049822 Bacteria 760
176 Ga0501044_0692725 3300049823 Unclassified 905
177 Ga0501045_0002621 3300049824 Bacteria 12242
178 Ga0501045_0355410 3300049824 Bacteria 1090
179 nmdc:mga0qj67_120350_c1 3300050509 Bacteria 2123
180 nmdc:mga06r32_4396_c1 3300050510 Bacteria 12607
181 Ga0501084_0026687 3300054114 Bacteria 4822
182 Ga0501084_0076373 3300054114 Bacteria 2808
183 Ga0501084_0220140 3300054114 Bacteria 1602
184 Ga0501082_0001897 3300060353 Bacteria 18372
185 Ga0501082_0003784 3300060353 Bacteria 13224
186 Ga0501082_0187030 3300060353 Bacteria 1802
187 Ga0530510_0028488 3300061734 Bacteria 4005
188 Ga0530510_0134317 3300061734 Bacteria 1821
189 Ga0530510_0351279 3300061734 Bacteria 1107
190 Ga0373947_0091270
191 Ga0070671_100764331
192 Ga0070659_100205264
193 Ga0070711_100336401
194 Ga0070699_100325940
195 Ga0070684_100619514
196 Ga0068853_100570581
197 Ga0070686_100751345
198 Ga0068861_100114478
199 Ga0068870_10162490
200 Ga0081455_10002019
201 Ga0081455_10081634
202 Ga0081455_10104926
203 Ga0081538_10013472
204 Ga0081540_1209951
205 Ga0075430_100086957
206 Ga0075431_100000036
207 Ga0068865_100364542
208 Ga0111539_10379787
209 Ga0105245_10324456
210 Ga0105245_10483381
211 Ga0114129_10775081
212 Ga0105243_10416423
213 Ga0105246_10028046
214 Ga0163163_10067715
215 Ga0163163_11032200
216 Ga0157380_10413573
217 Ga0182008_10171586
218 Ga0207643_10040311
219 Ga0207709_10352157
220 Ga0207708_10182957
221 Ga0207675_100173561
222 Ga0307416_100456885
223 Ga0307415_100776274
224 Ga0373935_0076920
225 Ga0373925_0586846
226 Ga0395900_0856089
227 Ga0395898_0134840
228 Ga0395898_0477495
229 Ga0395901_0082099
230 Ga0395901_0136536
231 Ga0242420_070709
232 Ga0451837_0904574
233 Ga0439448_0021759
234 Ga0439450_007433
235 Ga0439463_000164
236 Ga0439460_0039857
237 Ga0439440_0023796
238 Ga0466963_0038202
239 Ga0466964_0043349
240 Ga0466957_0010483
241 Ga0466960_0024190
242 Ga0466967_0190433
243 Ga0466967_0260668
244 Ga0466967_1145462
245 Ga0495603_0096816
246 Ga0495653_0166778
247 Ga0495582_0053864
248 Ga0495608_0369488
249 Ga0495665_0144396
250 Ga0495640_0201845
251 Ga0495586_0130982
252 Ga0495634_0038049
253 Ga0495658_0039632
254 Ga0495676_0123606
255 Ga0496100_0014051
256 Ga0496100_0382877
257 Ga0496101_0001556
258 Ga0496101_0009763
259 Ga0496101_0034182
260 Ga0496102_0028125
261 Ga0496102_0147906
262 Ga0496102_0179867
263 Ga0496104_0540755
264 Ga0496104_0845730
265 Ga0496106_0009834
266 Ga0496106_0058659
267 Ga0496107_0006440
268 Ga0496107_0032007
269 Ga0496108_0015388
270 Ga0496109_0019694
271 Ga0496109_0426789
272 Ga0496109_0871341
273 Ga0496110_0032739
274 Ga0496112_0019935
275 Ga0496112_0415249
276 Ga0496113_0035832
277 Ga0496114_0059002
278 Ga0496114_0088714
279 Ga0496115_0040126
280 Ga0496115_0192112
281 Ga0501031_0009262
282 Ga0501031_0127471
283 Ga0501032_0186699
284 Ga0501033_0023459
285 Ga0501036_0002212
286 Ga0501036_0010340
287 Ga0501036_0048739
288 Ga0501036_0101755
289 Ga0501036_0370492
290 Ga0501037_0212083
291 Ga0501038_0011626
292 Ga0501038_0081965
293 Ga0501039_0000806
294 Ga0501039_0022513
295 Ga0501039_0246660
296 Ga0501039_0383072
297 Ga0501039_0451739
298 Ga0501040_0006578
299 Ga0501040_0056785
300 Ga0501040_0303874
301 Ga0501041_0005039
302 Ga0501041_0009967
303 Ga0501041_0013658
304 Ga0501041_0200820
305 Ga0501041_0402992
306 Ga0501042_0000319
307 Ga0501042_0010758
308 Ga0501042_0013293
309 Ga0501043_0094725
310 Ga0501043_0282158
311 Ga0501043_0544517
312 Ga0501043_0635574
313 Ga0501046_0012256
314 Ga0501046_0017236
315 Ga0501048_0281411
316 Ga0501048_0319891
317 Ga0501067_0000059
318 Ga0501067_0117978
319 Ga0501067_0395398
320 Ga0501068_0003611
321 Ga0501068_0110121
322 Ga0501068_0114185
323 Ga0501068_0302408
324 Ga0501069_0000872
325 Ga0501069_0172965
326 Ga0501069_0249998
327 Ga0501070_0035612
328 Ga0501070_0077764
329 Ga0501071_0001155
330 Ga0501071_0098530
331 Ga0501072_0019104
332 Ga0501072_0034018
333 Ga0501072_0038410
334 Ga0501072_0049740
335 Ga0501072_0159762
336 Ga0501072_0798036
337 Ga0501073_0151924
338 Ga0501074_0004036
339 Ga0501074_0026749
340 Ga0501075_0000115
341 Ga0501075_0009221
342 Ga0501075_0103376
343 Ga0501076_0001673
344 Ga0501076_0005968
345 Ga0501076_0009491
346 Ga0501076_0074956
347 Ga0501077_0016777
348 Ga0501077_0043891
349 Ga0501077_0080521
350 Ga0501077_0770669
351 Ga0501079_0018607
352 Ga0501079_0028064
353 Ga0501079_0089647
354 Ga0501079_0158290
355 Ga0501080_0063556
356 Ga0501080_0096281
357 Ga0501081_0014187
358 Ga0501081_0045400
359 Ga0501081_0066945
360 Ga0501081_0348523
361 Ga0501083_0387236
362 Ga0501035_0164249
363 Ga0501035_0497957
364 Ga0501035_0788058
365 Ga0501044_0692725
366 Ga0501045_0002621
367 Ga0501045_0355410
368 nmdc:mga0qj67_120350_c1
369 nmdc:mga06r32_4396_c1
370 Ga0501084_0026687
371 Ga0501084_0076373
372 Ga0501084_0220140
373 Ga0501082_0001897
374 Ga0501082_0003784
375 Ga0501082_0187030
376 Ga0530510_0028488
377 Ga0530510_0134317
378 Ga0530510_0351279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

82

212

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f8k-assembly1.cif.gz_A crystal structure of protein acetyltransferase (pat) from sulfolobus solfataricus 0.8398 75 201
4ava-assembly1.cif.gz_A crystal structure of protein lysine acetyltransferase rv0998 from mycobacterium tuberculosis 0.7832 75 200
7ovv-assembly1.cif.gz_A crystal structure of the arabidopsis thaliana thialysine acetyltransferase atnata2 0.7635 83 156
7zhc-assembly1.cif.gz_B moss spermine/spermidine acetyl transferase (ppssat) in complex with acetylcoa and polyethylen glycol 0.762 83 156
1xeb-assembly5.cif.gz_E crystal structure of an acyl-coa n-acyltransferase from pseudomonas aeruginosa 0.7585 75 198
ID Description Score Start End Superfamily
af_Q8N8M0_58_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8874 74 152 3.40.630.30
af_Q0D8A4_1_78_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8419 119 156 3.40.630.30
af_Q4CWW7_1_261_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8233 75 90 3.30.930.10
3f8kA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.822 75 198 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8071 77 153 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6N7EII5-F1-model_v4 GNAT family N-acetyltransferase 0.966 9 201 GO:0016747
AF-A0A4R0JDF4-F1-model_v4 GNAT family N-acetyltransferase 0.9593 11 201 GO:0016747
AF-A0A4R0HLR0-F1-model_v4 GNAT family N-acetyltransferase 0.9508 8 201 GO:0016747
AF-A0A4R0JDF4-F1-model_v4 GNAT family N-acetyltransferase 0.9494 11 201 GO:0016747
AF-A0A6A7MK87-F1-model_v4 deleted 0.9491 32 201

Map