F291177

General Info

Members Datasets Scaffolds Average Seq Length
189 125 189 75

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101354347|Ga0307408_1013543471
Length 91
Sequence MTNPAPIDDVPIGGEVIRLGQFLKFAGLLDSGGNVKEAIIDGYVAVNGEVDRRRGRQLQLGDIVSFEGRRVRVVRESTEADGDMDHQAQKR

Samples

Sample ID Description Type Environment
1 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
68 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
69 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 2.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 17.46
Rhizosphere 49.74
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000530 3300002772 Bacteria 18007
2 JGI25165J46597_1000004 3300003214 Bacteria 667510
3 JGI25165J46597_1000174 3300003214 Bacteria 100372
4 rootH2_10139412 3300003320 Bacteria 1761
5 Ga0006562J51391_1167873 3300003578 Bacteria 1889
6 Ga0006562J51391_1167874 3300003578 Bacteria 1840
7 Ga0055533_1000001 3300003756 Bacteria 1863437
8 Ga0055525_1000150 3300003759 Bacteria 94263
9 Ga0055529_1042077 3300003763 Bacteria 552
10 Ga0055541_1000492 3300003841 Bacteria 11109
11 Ga0070663_100594222 3300005455 Bacteria 930
12 Ga0070665_100268876 3300005548 Bacteria 1706
13 Ga0068855_102392100 3300005563 Bacteria 527
14 Ga0075368_10019865 3300006042 Bacteria 2539
15 Ga0075363_100105074 3300006048 Bacteria 1566
16 Ga0075369_10097877 3300006186 Bacteria 1314
17 Ga0075366_10642879 3300006195 Bacteria 658
18 Ga0075370_10113452 3300006353 Bacteria 1575
19 Ga0105244_10045727 3300009036 Bacteria 2251
20 Ga0105247_10904499 3300009101 Bacteria 682
21 Ga0105242_11610038 3300009176 Bacteria 683
22 Ga0105237_10150658 3300009545 Bacteria 2322
23 Ga0105238_12239158 3300009551 Bacteria 581
24 Ga0105246_10909595 3300011119 Bacteria 790
25 Ga0157373_10682292 3300013100 Bacteria 752
26 Ga0157371_10928423 3300013102 Bacteria 661
27 Ga0157371_11164381 3300013102 Bacteria 593
28 Ga0157370_10411495 3300013104 Bacteria 1244
29 Ga0157369_10086926 3300013105 Bacteria 3339
30 Ga0157369_10143884 3300013105 Bacteria 2521
31 Ga0157369_10234940 3300013105 Bacteria 1916
32 Ga0157369_10289903 3300013105 Bacteria 1704
33 Ga0157369_10730030 3300013105 Bacteria 1019
34 Ga0157369_11837820 3300013105 Bacteria 615
35 Ga0171462_1005 3300013250 Bacteria 598379
36 Ga0163162_10776736 3300013306 Bacteria 1076
37 Ga0163162_10876180 3300013306 Bacteria 1012
38 Ga0157372_10115190 3300013307 Bacteria 3082
39 Ga0157372_10164540 3300013307 Bacteria 2565
40 Ga0157372_10186026 3300013307 Bacteria 2405
41 Ga0157372_13242185 3300013307 Bacteria 519
42 Ga0157375_10340776 3300013308 Bacteria 1664
43 Ga0157375_12921668 3300013308 Bacteria 571
44 Ga0163163_13162035 3300014325 Bacteria 513
45 Ga0157380_10924550 3300014326 Bacteria 900
46 Ga0163161_10113019 3300017792 Bacteria 2032
47 Ga0197907_10973448 3300020069 Bacteria 1940
48 Ga0206353_10901265 3300020082 Bacteria 5146
49 Ga0209566_100053 3300025225 Bacteria 224436
50 Ga0209674_100001 3300025226 Bacteria 4013750
51 Ga0209672_117551 3300025228 Bacteria 753
52 Ga0209563_100001 3300025230 Bacteria 4013775
53 Ga0207427_100010 3300025231 Bacteria 648610
54 Ga0209437_100290 3300025233 Bacteria 72971
55 Ga0209677_100001 3300025253 Bacteria 4013787
56 Ga0209677_100169 3300025253 Bacteria 55922
57 Ga0209233_1000001 3300025261 Bacteria 2992747
58 Ga0209455_1000567 3300025272 Bacteria 24566
59 Ga0207655_1141598 3300025728 Bacteria 771
60 Ga0207688_10109586 3300025901 Bacteria 1602
61 Ga0207705_10199966 3300025909 Bacteria 1514
62 Ga0207671_10252829 3300025914 Bacteria 1385
63 Ga0207662_10334054 3300025918 Bacteria 1014
64 Ga0207657_11231714 3300025919 Bacteria 568
65 Ga0207668_11256492 3300025972 Bacteria 666
66 Ga0207678_10698332 3300026067 Bacteria 893
67 Ga0268266_10193256 3300028379 Bacteria 1859
68 Ga0307408_101354347 3300031548 Bacteria 669
69 Ga0307405_10527176 3300031731 Bacteria 952
70 Ga0307413_10221308 3300031824 Bacteria 1383
71 Ga0307406_10033329 3300031901 Bacteria 3152
72 Ga0307406_11621820 3300031901 Bacteria 572
73 Ga0307407_11580308 3300031903 Bacteria 520
74 Ga0307412_10500054 3300031911 Bacteria 1012
75 Ga0307409_100094891 3300031995 Bacteria 2456
76 Ga0307409_100511071 3300031995 Bacteria 1172
77 Ga0307409_100738082 3300031995 Bacteria 987
78 Ga0307409_101654029 3300031995 Bacteria 669
79 Ga0307409_102972998 3300031995 Bacteria 500
80 Ga0307416_100459747 3300032002 Bacteria 1328
81 Ga0307416_100727328 3300032002 Bacteria 1084
82 Ga0307416_101080441 3300032002 Bacteria 907
83 Ga0307416_103189992 3300032002 Bacteria 549
84 Ga0307414_10291590 3300032004 Bacteria 1376
85 Ga0307414_10375382 3300032004 Bacteria 1228
86 Ga0307415_100815992 3300032126 Bacteria 853
87 Ga0395899_0013020 3300037312 Bacteria 6363
88 Ga0395899_0275976 3300037312 Bacteria 1145
89 Ga0395900_0017132 3300037418 Bacteria 7397
90 Ga0395900_0697004 3300037418 Bacteria 949
91 Ga0395898_0000256 3300037466 Bacteria 130878
92 Ga0439465_0029834 3300041413 Bacteria 1733
93 Ga0451791_0698578 3300041451 Bacteria 572
94 Ga0451806_839316 3300041462 Eukaryota 1450
95 Ga0451837_1525805 3300041494 Bacteria 570
96 Ga0451839_1134300 3300041496 Bacteria 966
97 Ga0451841_1040285 3300041498 Bacteria 609
98 Ga0451841_1076676 3300041498 Bacteria 905
99 Ga0451847_0934385 3300041503 Bacteria 573
100 Ga0451847_1008900 3300041503 Bacteria 709
101 Ga0451853_0047958 3300041512 Bacteria 528
102 Ga0451853_1483687 3300041512 Bacteria 1197
103 Ga0451853_2459320 3300041512 Bacteria 1003
104 Ga0451853_2867159 3300041512 Bacteria 773
105 Ga0451853_3948813 3300041512 Bacteria 829
106 Ga0451853_3956875 3300041512 Bacteria 966
107 Ga0466969_0479672 3300044656 Bacteria 567
108 Ga0466965_0403494 3300044683 Bacteria 755
109 Ga0466961_0361421 3300044693 Bacteria 883
110 Ga0466968_0034313 3300044735 Bacteria 2117
111 Ga0466970_0363238 3300044765 Bacteria 822
112 Ga0466970_0626186 3300044765 Bacteria 625
113 Ga0466970_0698342 3300044765 Bacteria 591
114 Ga0466957_0198462 3300044842 Bacteria 1317
115 Ga0466960_0111449 3300044901 Bacteria 1422
116 Ga0466960_0142753 3300044901 Bacteria 1273
117 Ga0466959_0639688 3300045049 Bacteria 714
118 Ga0466959_0712284 3300045049 Bacteria 672
119 Ga0466959_0783518 3300045049 Bacteria 638
120 Ga0466958_0472772 3300045836 Bacteria 812
121 Ga0495638_0450119 3300046460 Bacteria 658
122 Ga0495650_0115720 3300046471 Bacteria 991
123 Ga0495610_0209267 3300046512 Bacteria 794
124 Ga0495620_0107424 3300046515 Bacteria 1108
125 Ga0495598_0104515 3300046537 Bacteria 941
126 Ga0495621_0423402 3300046539 Bacteria 567
127 Ga0495649_0669637 3300046694 Bacteria 510
128 Ga0495686_0520446 3300047472 Bacteria 624
129 Ga0495686_0619291 3300047472 Bacteria 559
130 Ga0496100_0156202 3300048903 Bacteria 1631
131 Ga0496101_0165133 3300048904 Bacteria 1699
132 Ga0496101_0639673 3300048904 Bacteria 840
133 Ga0496102_0362709 3300048905 Bacteria 1364
134 Ga0496102_0411266 3300048905 Bacteria 1271
135 Ga0496103_0189468 3300048906 Bacteria 1322
136 Ga0496103_0413711 3300048906 Bacteria 866
137 Ga0496104_0012741 3300048907 Bacteria 7574
138 Ga0496105_0263613 3300048908 Bacteria 1393
139 Ga0496105_0356512 3300048908 Bacteria 1167
140 Ga0496105_0415646 3300048908 Bacteria 1065
141 Ga0496105_0716050 3300048908 Bacteria 767
142 Ga0496107_0290168 3300048910 Bacteria 1218
143 Ga0496107_0367191 3300048910 Bacteria 1070
144 Ga0496108_0175726 3300048911 Bacteria 1854
145 Ga0496108_0321156 3300048911 Bacteria 1350
146 Ga0496109_0024362 3300048912 Bacteria 5380
147 Ga0496109_0029628 3300048912 Bacteria 4903
148 Ga0496110_0095778 3300048913 Bacteria 2659
149 Ga0496111_0026794 3300048914 Bacteria 4072
150 Ga0496111_0346387 3300048914 Bacteria 1100
151 Ga0496111_0460131 3300048914 Bacteria 938
152 Ga0496112_0596799 3300048915 Bacteria 1036
153 Ga0496112_0836407 3300048915 Bacteria 844
154 Ga0496113_0064363 3300048916 Bacteria 2772
155 Ga0496114_0125831 3300048917 Bacteria 2209
156 Ga0496114_0176071 3300048917 Bacteria 1867
157 Ga0496114_1540384 3300048917 Bacteria 553
158 Ga0496115_0024844 3300048918 Bacteria 4660
159 Ga0496115_0033793 3300048918 Bacteria 4039
160 Ga0496115_0142884 3300048918 Bacteria 1974
161 Ga0496117_0001823 3300048920 Bacteria 28921
162 Ga0496117_0021286 3300048920 Bacteria 5253
163 Ga0496118_0007068 3300048921 Bacteria 12059
164 Ga0496118_0042979 3300048921 Bacteria 3558
165 Ga0496118_0326531 3300048921 Bacteria 830
166 Ga0496119_0002305 3300048922 Bacteria 21101
167 Ga0496119_0340722 3300048922 Bacteria 729
168 Ga0496120_0014575 3300048923 Bacteria 5233
169 Ga0496120_0139283 3300048923 Bacteria 1234
170 Ga0496121_0882828 3300048924 Bacteria 516
171 Ga0496122_0001218 3300048925 Bacteria 43657
172 Ga0496122_0080164 3300048925 Bacteria 2278
173 Ga0496123_0000009 3300048926 Bacteria 509486
174 Ga0496123_0022374 3300048926 Bacteria 4874
175 Ga0496124_0004908 3300048927 Bacteria 15366
176 Ga0496124_0109440 3300048927 Bacteria 2227
177 Ga0496124_0652246 3300048927 Bacteria 675
178 Ga0496125_0008791 3300048928 Bacteria 10502
179 Ga0496126_0007850 3300048929 Bacteria 11626
180 Ga0496126_1049512 3300048929 Unclassified 608
181 Ga0501038_0229511 3300049574 Bacteria 1478
182 Ga0501039_0471245 3300049575 Bacteria 986
183 Ga0501070_0001496 3300049586 Bacteria 20884
184 nmdc:mga03n38_323618_c1 3300050490 Bacteria 833
185 nmdc:mga0yw44_949490_c1 3300050492 Bacteria 583
186 Ga0500635_0000234 3300053080 Bacteria 24552
187 Ga0500616_0000113 3300053153 Bacteria 150722
188 Ga0500645_005512 3300053730 Bacteria 4643
189 Ga0466962_0616431 3300061719 Bacteria 554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_1076676 Ga0451841_1076676_533_757 74
2 3300041512 Ga0451853_1483687 Ga0451853_1483687_699_923 74
3 3300002772 JGI25164J39214_1000530 JGI25164J39214_100053015 75
4 3300003214 JGI25165J46597_1000004 JGI25165J46597_100000440 75
5 3300003214 JGI25165J46597_1000174 JGI25165J46597_100017471 75
6 3300003320 rootH2_10139412 rootH2_101394122 75
7 3300003578 Ga0006562J51391_1167873 Ga0006562J51391_11678732 75
8 3300003578 Ga0006562J51391_1167874 Ga0006562J51391_11678744 75
9 3300003756 Ga0055533_1000001 Ga0055533_10000011452 75
10 3300003759 Ga0055525_1000150 Ga0055525_100015039 75
11 3300003763 Ga0055529_1042077 Ga0055529_10420772 75
12 3300003841 Ga0055541_1000492 Ga0055541_10004926 75
13 3300005455 Ga0070663_100594222 Ga0070663_1005942221 75
14 3300005548 Ga0070665_100268876 Ga0070665_1002688762 75
15 3300005563 Ga0068855_102392100 Ga0068855_1023921002 75
16 3300006042 Ga0075368_10019865 Ga0075368_100198653 75
17 3300006048 Ga0075363_100105074 Ga0075363_1001050741 75
18 3300006186 Ga0075369_10097877 Ga0075369_100978772 75
19 3300006195 Ga0075366_10642879 Ga0075366_106428791 75
20 3300006353 Ga0075370_10113452 Ga0075370_101134522 75
21 3300009036 Ga0105244_10045727 Ga0105244_100457273 75
22 3300009101 Ga0105247_10904499 Ga0105247_109044991 75
23 3300009176 Ga0105242_11610038 Ga0105242_116100382 75
24 3300009545 Ga0105237_10150658 Ga0105237_101506584 75
25 3300009551 Ga0105238_12239158 Ga0105238_122391581 75
26 3300011119 Ga0105246_10909595 Ga0105246_109095952 75
27 3300013100 Ga0157373_10682292 Ga0157373_106822922 75
28 3300013102 Ga0157371_10928423 Ga0157371_109284232 75
29 3300013102 Ga0157371_11164381 Ga0157371_111643812 75
30 3300013104 Ga0157370_10411495 Ga0157370_104114952 75
31 3300013105 Ga0157369_10086926 Ga0157369_100869268 75
32 3300013105 Ga0157369_10143884 Ga0157369_101438844 75
33 3300013105 Ga0157369_10234940 Ga0157369_102349403 75
34 3300013105 Ga0157369_10289903 Ga0157369_102899033 75
35 3300013105 Ga0157369_10730030 Ga0157369_107300302 75
36 3300013105 Ga0157369_11837820 Ga0157369_118378202 75
37 3300013250 Ga0171462_1005 Ga0171462_1005100 75
38 3300013306 Ga0163162_10776736 Ga0163162_107767362 75
39 3300013306 Ga0163162_10876180 Ga0163162_108761802 75
40 3300013307 Ga0157372_10115190 Ga0157372_101151905 75
41 3300013307 Ga0157372_10164540 Ga0157372_101645402 75
42 3300013307 Ga0157372_10186026 Ga0157372_101860264 75
43 3300013307 Ga0157372_13242185 Ga0157372_132421852 75
44 3300013308 Ga0157375_10340776 Ga0157375_103407762 75
45 3300013308 Ga0157375_12921668 Ga0157375_129216682 75
46 3300014325 Ga0163163_13162035 Ga0163163_131620351 75
47 3300014326 Ga0157380_10924550 Ga0157380_109245502 75
48 3300017792 Ga0163161_10113019 Ga0163161_101130192 75
49 3300020069 Ga0197907_10973448 Ga0197907_109734481 75
50 3300020082 Ga0206353_10901265 Ga0206353_109012654 75
51 3300025225 Ga0209566_100053 Ga0209566_10005338 75
52 3300025226 Ga0209674_100001 Ga0209674_1000011452 75
53 3300025228 Ga0209672_117551 Ga0209672_1175511 75
54 3300025230 Ga0209563_100001 Ga0209563_1000011452 75
55 3300025231 Ga0207427_100010 Ga0207427_100010541 75
56 3300025233 Ga0209437_100290 Ga0209437_1002909 75
57 3300025253 Ga0209677_100001 Ga0209677_1000011452 75
58 3300025253 Ga0209677_100169 Ga0209677_10016913 75
59 3300025261 Ga0209233_1000001 Ga0209233_10000011408 75
60 3300025272 Ga0209455_1000567 Ga0209455_100056721 75
61 3300025728 Ga0207655_1141598 Ga0207655_11415982 75
62 3300025901 Ga0207688_10109586 Ga0207688_101095862 75
63 3300025909 Ga0207705_10199966 Ga0207705_101999662 75
64 3300025914 Ga0207671_10252829 Ga0207671_102528294 75
65 3300025918 Ga0207662_10334054 Ga0207662_103340542 75
66 3300025919 Ga0207657_11231714 Ga0207657_112317142 75
67 3300025972 Ga0207668_11256492 Ga0207668_112564922 75
68 3300026067 Ga0207678_10698332 Ga0207678_106983322 75
69 3300028379 Ga0268266_10193256 Ga0268266_101932562 75
70 3300031548 Ga0307408_101354347 Ga0307408_1013543471 75
71 3300031731 Ga0307405_10527176 Ga0307405_105271763 75
72 3300031824 Ga0307413_10221308 Ga0307413_102213082 75
73 3300031901 Ga0307406_10033329 Ga0307406_100333292 75
74 3300031901 Ga0307406_11621820 Ga0307406_116218201 75
75 3300031903 Ga0307407_11580308 Ga0307407_115803081 75
76 3300031911 Ga0307412_10500054 Ga0307412_105000542 75
77 3300031995 Ga0307409_100094891 Ga0307409_1000948912 75
78 3300031995 Ga0307409_100511071 Ga0307409_1005110711 75
79 3300031995 Ga0307409_100738082 Ga0307409_1007380822 75
80 3300031995 Ga0307409_101654029 Ga0307409_1016540292 75
81 3300031995 Ga0307409_102972998 Ga0307409_1029729982 75
82 3300032002 Ga0307416_100459747 Ga0307416_1004597471 75
83 3300032002 Ga0307416_100727328 Ga0307416_1007273282 75
84 3300032002 Ga0307416_101080441 Ga0307416_1010804412 75
85 3300032002 Ga0307416_103189992 Ga0307416_1031899921 75
86 3300032004 Ga0307414_10291590 Ga0307414_102915902 75
87 3300032004 Ga0307414_10375382 Ga0307414_103753823 75
88 3300032126 Ga0307415_100815992 Ga0307415_1008159921 75
89 3300037312 Ga0395899_0013020 Ga0395899_0013020_3252_3479 75
90 3300037312 Ga0395899_0275976 Ga0395899_0275976_325_552 75
91 3300037418 Ga0395900_0017132 Ga0395900_0017132_3914_4141 75
92 3300037418 Ga0395900_0697004 Ga0395900_0697004_33_260 75
93 3300037466 Ga0395898_0000256 Ga0395898_0000256_11488_11715 75
94 3300041413 Ga0439465_0029834 Ga0439465_0029834_209_436 75
95 3300041451 Ga0451791_0698578 Ga0451791_0698578_267_494 75
96 3300041462 Ga0451806_839316 Ga0451806_839316_1209_1436 75
97 3300041494 Ga0451837_1525805 Ga0451837_1525805_203_430 75
98 3300041496 Ga0451839_1134300 Ga0451839_1134300_339_566 75
99 3300041498 Ga0451841_1040285 Ga0451841_1040285_315_542 75
100 3300041503 Ga0451847_0934385 Ga0451847_0934385_212_439 75
101 3300041503 Ga0451847_1008900 Ga0451847_1008900_359_586 75
102 3300041512 Ga0451853_0047958 Ga0451853_0047958_212_439 75
103 3300041512 Ga0451853_2459320 Ga0451853_2459320_690_917 75
104 3300041512 Ga0451853_2867159 Ga0451853_2867159_151_378 75
105 3300041512 Ga0451853_3948813 Ga0451853_3948813_544_771 75
106 3300041512 Ga0451853_3956875 Ga0451853_3956875_554_781 75
107 3300044656 Ga0466969_0479672 Ga0466969_0479672_244_471 75
108 3300044683 Ga0466965_0403494 Ga0466965_0403494_371_598 75
109 3300044693 Ga0466961_0361421 Ga0466961_0361421_274_501 75
110 3300044735 Ga0466968_0034313 Ga0466968_0034313_1849_2076 75
111 3300044765 Ga0466970_0363238 Ga0466970_0363238_475_702 75
112 3300044765 Ga0466970_0626186 Ga0466970_0626186_220_447 75
113 3300044765 Ga0466970_0698342 Ga0466970_0698342_30_257 75
114 3300044842 Ga0466957_0198462 Ga0466957_0198462_454_681 75
115 3300044901 Ga0466960_0111449 Ga0466960_0111449_610_837 75
116 3300044901 Ga0466960_0142753 Ga0466960_0142753_402_629 75
117 3300045049 Ga0466959_0639688 Ga0466959_0639688_305_532 75
118 3300045049 Ga0466959_0712284 Ga0466959_0712284_54_281 75
119 3300045049 Ga0466959_0783518 Ga0466959_0783518_338_565 75
120 3300045836 Ga0466958_0472772 Ga0466958_0472772_61_288 75
121 3300046460 Ga0495638_0450119 Ga0495638_0450119_128_355 75
122 3300046471 Ga0495650_0115720 Ga0495650_0115720_516_743 75
123 3300046512 Ga0495610_0209267 Ga0495610_0209267_173_400 75
124 3300046515 Ga0495620_0107424 Ga0495620_0107424_394_621 75
125 3300046537 Ga0495598_0104515 Ga0495598_0104515_369_596 75
126 3300046539 Ga0495621_0423402 Ga0495621_0423402_304_531 75
127 3300046694 Ga0495649_0669637 Ga0495649_0669637_20_247 75
128 3300047472 Ga0495686_0520446 Ga0495686_0520446_39_266 75
129 3300047472 Ga0495686_0619291 Ga0495686_0619291_100_327 75
130 3300048903 Ga0496100_0156202 Ga0496100_0156202_592_819 75
131 3300048904 Ga0496101_0165133 Ga0496101_0165133_1106_1333 75
132 3300048904 Ga0496101_0639673 Ga0496101_0639673_92_319 75
133 3300048905 Ga0496102_0362709 Ga0496102_0362709_421_648 75
134 3300048905 Ga0496102_0411266 Ga0496102_0411266_181_408 75
135 3300048906 Ga0496103_0189468 Ga0496103_0189468_270_497 75
136 3300048906 Ga0496103_0413711 Ga0496103_0413711_89_316 75
137 3300048907 Ga0496104_0012741 Ga0496104_0012741_3206_3433 75
138 3300048908 Ga0496105_0263613 Ga0496105_0263613_461_688 75
139 3300048908 Ga0496105_0356512 Ga0496105_0356512_486_713 75
140 3300048908 Ga0496105_0415646 Ga0496105_0415646_484_711 75
141 3300048908 Ga0496105_0716050 Ga0496105_0716050_51_278 75
142 3300048910 Ga0496107_0290168 Ga0496107_0290168_254_481 75
143 3300048910 Ga0496107_0367191 Ga0496107_0367191_201_428 75
144 3300048911 Ga0496108_0175726 Ga0496108_0175726_533_760 75
145 3300048911 Ga0496108_0321156 Ga0496108_0321156_235_462 75
146 3300048912 Ga0496109_0024362 Ga0496109_0024362_1658_1885 75
147 3300048912 Ga0496109_0029628 Ga0496109_0029628_1086_1313 75
148 3300048913 Ga0496110_0095778 Ga0496110_0095778_811_1038 75
149 3300048914 Ga0496111_0026794 Ga0496111_0026794_867_1094 75
150 3300048914 Ga0496111_0346387 Ga0496111_0346387_500_727 75
151 3300048914 Ga0496111_0460131 Ga0496111_0460131_178_405 75
152 3300048915 Ga0496112_0596799 Ga0496112_0596799_655_882 75
153 3300048915 Ga0496112_0836407 Ga0496112_0836407_25_252 75
154 3300048916 Ga0496113_0064363 Ga0496113_0064363_765_992 75
155 3300048917 Ga0496114_0125831 Ga0496114_0125831_248_475 75
156 3300048917 Ga0496114_0176071 Ga0496114_0176071_754_981 75
157 3300048917 Ga0496114_1540384 Ga0496114_1540384_169_396 75
158 3300048918 Ga0496115_0024844 Ga0496115_0024844_3853_4080 75
159 3300048918 Ga0496115_0033793 Ga0496115_0033793_3225_3452 75
160 3300048918 Ga0496115_0142884 Ga0496115_0142884_659_886 75
161 3300048920 Ga0496117_0001823 Ga0496117_0001823_23648_23875 75
162 3300048920 Ga0496117_0021286 Ga0496117_0021286_1975_2202 75
163 3300048921 Ga0496118_0007068 Ga0496118_0007068_1596_1823 75
164 3300048921 Ga0496118_0042979 Ga0496118_0042979_1252_1506 75
165 3300048921 Ga0496118_0326531 Ga0496118_0326531_13_240 75
166 3300048922 Ga0496119_0002305 Ga0496119_0002305_4212_4466 75
167 3300048922 Ga0496119_0340722 Ga0496119_0340722_257_484 75
168 3300048923 Ga0496120_0014575 Ga0496120_0014575_1635_1889 75
169 3300048923 Ga0496120_0139283 Ga0496120_0139283_727_954 75
170 3300048924 Ga0496121_0882828 Ga0496121_0882828_272_499 75
171 3300048925 Ga0496122_0001218 Ga0496122_0001218_36350_36577 75
172 3300048925 Ga0496122_0080164 Ga0496122_0080164_1617_1844 75
173 3300048926 Ga0496123_0000009 Ga0496123_0000009_471869_472096 75
174 3300048926 Ga0496123_0022374 Ga0496123_0022374_4103_4330 75
175 3300048927 Ga0496124_0004908 Ga0496124_0004908_5620_5847 75
176 3300048927 Ga0496124_0109440 Ga0496124_0109440_1736_1963 75
177 3300048927 Ga0496124_0652246 Ga0496124_0652246_360_587 75
178 3300048928 Ga0496125_0008791 Ga0496125_0008791_9547_9774 75
179 3300048929 Ga0496126_0007850 Ga0496126_0007850_5094_5321 75
180 3300048929 Ga0496126_1049512 Ga0496126_1049512_241_468 75
181 3300049574 Ga0501038_0229511 Ga0501038_0229511_1129_1356 75
182 3300049575 Ga0501039_0471245 Ga0501039_0471245_626_853 75
183 3300049586 Ga0501070_0001496 Ga0501070_0001496_15090_15317 75
184 3300050490 nmdc:mga03n38_323618_c1 nmdc:mga03n38_323618_c1_333_560 75
185 3300050492 nmdc:mga0yw44_949490_c1 nmdc:mga0yw44_949490_c1_242_469 75
186 3300053080 Ga0500635_0000234 Ga0500635_0000234_7620_7847 75
187 3300053153 Ga0500616_0000113 Ga0500616_0000113_83089_83316 75
188 3300053730 Ga0500645_005512 Ga0500645_005512_2623_2850 75
189 3300061719 Ga0466962_0616431 Ga0466962_0616431_10_237 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13275

S4_2

S4 domain

10

74

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yef-assembly1.cif.gz_d 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9405 35 66
7m4y-assembly1.cif.gz_d a. baumannii ribosome-eravacycline complex: e-site trna 70s 0.9319 34 66
6ywy-assembly1.cif.gz_DD the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9242 35 67
2f4v-assembly1.cif.gz_D 30s ribosome + designer antibiotic 0.918 35 66
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9162 18 66
ID Description Score Start End Superfamily
2qalD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9284 34 66 3.10.290.10
af_P0AAS7_1_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9238 7 75 3.10.290.10
af_Q5A6Q6_103_204_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9214 18 67 3.10.290.10
af_P27929_102_235_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9179 18 67 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9064 18 67 3.10.290.10
ID Description Score Start End GO Terms
AF-G7H224-F1-model_v4 Uncharacterized protein 0.9853 7 73 GO:0003723
AF-A0A810MP00-F1-model_v4 deleted 0.9698 7 75
AF-A0A7W1V439-F1-model_v4 RNA-binding S4 domain-containing protein 0.9692 6 74 GO:0003723
AF-H6MSC8-F1-model_v4 RNA-binding S4 domain-containing protein 0.9691 7 75 GO:0003723
AF-A0A261D787-F1-model_v4 RNA-binding protein 0.9678 6 75 GO:0003723

Feature Viewer

pLDDT pTM Quality
86.65 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map