F291169

General Info

Members Datasets Scaffolds Average Seq Length
189 134 182 141

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10203213|Ga0307513_102032132
Length 157
Sequence MPDVEAATAARRPRSDAWQSAVTVLQEAAPPAIPPQAHAMTIVVEFPPGDPGTPPHRHPGPAFGLVLEGEMVFELEGEPARVVGAGEAFWEPGGDVIHYQDGNNRDDIPLRFTVTMLCEPGQPMLVLVDDDELARRRDRRAPHSTESIHVRQKGLKS

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
3 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
4 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.4
Nodule 0
Rhizoplane 0.53
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10203022 3300005341 Bacteria 1042
2 Ga0070668_100002321 3300005347 Bacteria 14003
3 Ga0070668_100270991 3300005347 Bacteria 1415
4 Ga0070674_100657337 3300005356 Bacteria 891
5 Ga0070714_100163921 3300005435 Bacteria 2013
6 Ga0070710_10393224 3300005437 Bacteria 927
7 Ga0070710_10597807 3300005437 Bacteria 767
8 Ga0070708_100034904 3300005445 Bacteria 4379
9 Ga0070708_100164283 3300005445 Bacteria 2070
10 Ga0070708_100726867 3300005445 Bacteria 934
11 Ga0070681_10593537 3300005458 Bacteria 1022
12 Ga0070685_10638250 3300005466 Bacteria 770
13 Ga0070706_100050468 3300005467 Bacteria 3839
14 Ga0070706_100163656 3300005467 Bacteria 2077
15 Ga0070706_100356360 3300005467 Bacteria 1364
16 Ga0070707_100029657 3300005468 Bacteria 5208
17 Ga0070698_100630465 3300005471 Bacteria 1013
18 Ga0070698_101194893 3300005471 Bacteria 710
19 Ga0070697_100430533 3300005536 Bacteria 1147
20 Ga0070693_100322460 3300005547 Bacteria 1048
21 Ga0070702_100001893 3300005615 Bacteria 8773
22 Ga0068860_100674359 3300005843 Bacteria 1042
23 Ga0081455_10107770 3300005937 Bacteria 2220
24 Ga0081455_10343711 3300005937 Bacteria 1055
25 Ga0070717_10168756 3300006028 Bacteria 1902
26 Ga0075365_10002619 3300006038 Bacteria 8911
27 Ga0075365_10011749 3300006038 Bacteria 5163
28 Ga0075365_10143039 3300006038 Bacteria 1661
29 Ga0075363_100001275 3300006048 Bacteria 9367
30 Ga0075363_100005859 3300006048 Bacteria 5527
31 Ga0075363_100035832 3300006048 Bacteria 2599
32 Ga0075363_100052022 3300006048 Bacteria 2186
33 Ga0075363_100060115 3300006048 Bacteria 2045
34 Ga0075364_10001085 3300006051 Bacteria 14508
35 Ga0075364_10013928 3300006051 Bacteria 4956
36 Ga0075364_10016139 3300006051 Bacteria 4643
37 Ga0075364_10043810 3300006051 Bacteria 2909
38 Ga0075364_10436309 3300006051 Bacteria 895
39 Ga0070715_10289694 3300006163 Bacteria 872
40 Ga0070712_100324208 3300006175 Bacteria 1253
41 Ga0070712_100678426 3300006175 Bacteria 877
42 Ga0070712_100983498 3300006175 Bacteria 730
43 Ga0075362_10017486 3300006177 Bacteria 2954
44 Ga0075362_10717676 3300006177 Bacteria 522
45 Ga0075367_10241465 3300006178 Bacteria 1132
46 Ga0075369_10042698 3300006186 Bacteria 1944
47 Ga0075369_10163671 3300006186 Bacteria 1020
48 Ga0075369_10337403 3300006186 Bacteria 706
49 Ga0075370_10000831 3300006353 Bacteria 12465
50 Ga0068871_100662368 3300006358 Bacteria 954
51 Ga0075430_100001965 3300006846 Bacteria 16911
52 Ga0075431_100002849 3300006847 Bacteria 16730
53 Ga0075429_100275360 3300006880 Bacteria 1474
54 Ga0075436_100668837 3300006914 Bacteria 768
55 Ga0099794_10078526 3300007265 Bacteria 1625
56 Ga0105250_10016603 3300009092 Bacteria 2998
57 Ga0105240_11121432 3300009093 Bacteria 836
58 Ga0114129_10095971 3300009147 Bacteria 4106
59 Ga0105243_10032869 3300009148 Bacteria 4010
60 Ga0105238_10235297 3300009551 Bacteria 1809
61 Ga0105249_10872506 3300009553 Bacteria 966
62 Ga0105239_10697617 3300010375 Bacteria 1160
63 Ga0105246_10686725 3300011119 Bacteria 895
64 Ga0157378_10006649 3300013297 Bacteria 10102
65 Ga0163162_10228586 3300013306 Bacteria 1991
66 Ga0157375_10009103 3300013308 Bacteria 8700
67 Ga0157376_10626581 3300014969 Bacteria 1073
68 Ga0207426_1000495 3300025302 Bacteria 58715
69 Ga0207692_10059708 3300025898 Bacteria 1970
70 Ga0207699_10187433 3300025906 Bacteria 1394
71 Ga0207684_10024483 3300025910 Bacteria 5146
72 Ga0207684_10030197 3300025910 Bacteria 4614
73 Ga0207684_10140104 3300025910 Bacteria 2079
74 Ga0207707_10516150 3300025912 Bacteria 1018
75 Ga0207693_10020967 3300025915 Bacteria 5195
76 Ga0207693_10940264 3300025915 Bacteria 662
77 Ga0207646_10033352 3300025922 Bacteria 4659
78 Ga0207646_10065272 3300025922 Bacteria 3249
79 Ga0207646_10169008 3300025922 Bacteria 1975
80 Ga0207646_10318357 3300025922 Bacteria 1406
81 Ga0207686_10171409 3300025934 Bacteria 1531
82 Ga0207709_10081893 3300025935 Bacteria 2082
83 Ga0207704_10625126 3300025938 Bacteria 884
84 Ga0207668_10007604 3300025972 Bacteria 6450
85 Ga0207668_10084876 3300025972 Bacteria 2308
86 Ga0207668_10733034 3300025972 Bacteria 871
87 Ga0207640_12146528 3300025981 Bacteria 507
88 Ga0207641_11398326 3300026088 Bacteria 701
89 Ga0207648_10229870 3300026089 Bacteria 1650
90 Ga0207683_10432928 3300026121 Bacteria 1212
91 Ga0268264_10033487 3300028381 Bacteria 4222
92 Ga0307512_10003136 3300030522 Bacteria 19661
93 Ga0307513_10203213 3300031456 Bacteria 1820
94 Ga0307508_10160034 3300031616 Bacteria 1855
95 Ga0307508_10282022 3300031616 Bacteria 1254
96 Ga0307516_10231283 3300031730 Bacteria 1552
97 Ga0307516_10980648 3300031730 Bacteria 516
98 Ga0307413_10303198 3300031824 Bacteria 1212
99 Ga0307410_10097760 3300031852 Bacteria 2098
100 Ga0307410_10668867 3300031852 Bacteria 873
101 Ga0307412_10101013 3300031911 Bacteria 2040
102 Ga0307409_100497667 3300031995 Bacteria 1186
103 Ga0307409_100938086 3300031995 Bacteria 881
104 Ga0307414_10522554 3300032004 Bacteria 1054
105 Ga0307411_10741190 3300032005 Bacteria 860
106 Ga0307411_10890753 3300032005 Bacteria 790
107 Ga0307415_101659837 3300032126 Bacteria 615
108 Ga0373936_0137431 3300035113 Bacteria 1053
109 Ga0395898_0003192 3300037466 Bacteria 18461
110 Ga0395898_0286692 3300037466 Bacteria 1571
111 Ga0395901_0242147 3300038443 Bacteria 1881
112 Ga0439461_0036975 3300041410 Bacteria 1041
113 Ga0439466_0008805 3300041411 Bacteria 3795
114 Ga0439465_0050184 3300041413 Bacteria 1364
115 Ga0451789_0423546 3300041443 Bacteria 616
116 Ga0439431_0006173 3300041997 Bacteria 2646
117 Ga0439445_0012537 3300042004 Bacteria 2039
118 Ga0439446_0131630 3300042156 Bacteria 812
119 Ga0439434_0001954 3300042435 Bacteria 5968
120 Ga0466965_0046041 3300044683 Bacteria 2158
121 Ga0466965_0086871 3300044683 Bacteria 1587
122 Ga0466968_0033607 3300044735 Bacteria 2137
123 Ga0466960_0000859 3300044901 Bacteria 10739
124 Ga0466967_0008129 3300045976 Bacteria 7656
125 Ga0466967_0017766 3300045976 Bacteria 5660
126 Ga0495638_0001007 3300046460 Bacteria 28225
127 Ga0495638_0098425 3300046460 Bacteria 1752
128 Ga0495641_0059390 3300046461 Bacteria 1729
129 Ga0495651_0159894 3300046462 Bacteria 1615
130 Ga0495582_0219678 3300046473 Bacteria 1087
131 Ga0495639_0050719 3300046475 Bacteria 1886
132 Ga0495606_0002644 3300046507 Bacteria 20452
133 Ga0495618_0496951 3300046514 Bacteria 736
134 Ga0495630_0867402 3300046517 Bacteria 688
135 Ga0495648_0001992 3300046524 Bacteria 19378
136 Ga0495654_0049547 3300046530 Bacteria 2057
137 Ga0495665_0377040 3300046531 Bacteria 721
138 Ga0495640_0521072 3300046533 Bacteria 722
139 Ga0495668_0000197 3300046616 Bacteria 88776
140 Ga0495611_0082341 3300046648 Bacteria 1481
141 Ga0495625_0002368 3300046660 Bacteria 20514
142 Ga0495625_0144724 3300046660 Bacteria 1601
143 Ga0495674_0449326 3300047319 Bacteria 1036
144 Ga0495672_0001245 3300047320 Bacteria 25576
145 Ga0495672_0060668 3300047320 Bacteria 2183
146 Ga0495672_0082777 3300047320 Bacteria 1784
147 Ga0495680_0568017 3300047322 Bacteria 762
148 Ga0495683_0091285 3300047323 Bacteria 1475
149 Ga0495673_0001225 3300047469 Bacteria 21286
150 Ga0495602_0791830 3300048088 Bacteria 637
151 Ga0495626_0000025 3300048091 Bacteria 209356
152 Ga0501038_0129649 3300049574 Bacteria 2072
153 nmdc:mga03n38_1445_c1 3300050490 Bacteria 6807
154 nmdc:mga03n38_19553_c1 3300050490 Bacteria 2693
155 nmdc:mga03n38_4432_c1 3300050490 Bacteria 4653
156 nmdc:mga03n38_69731_c1 3300050490 Bacteria 1624
157 nmdc:mga03n38_7578_c1 3300050490 Bacteria 3847
158 nmdc:mga00v17_147999_c1 3300050491 Bacteria 1508
159 nmdc:mga00v17_16792_c1 3300050491 Bacteria 4130
160 nmdc:mga00v17_254646_c1 3300050491 Bacteria 1138
161 nmdc:mga00v17_29172_c1 3300050491 Bacteria 3237
162 nmdc:mga00v17_77137_c1 3300050491 Bacteria 2074
163 nmdc:mga00v17_93866_c1 3300050491 Bacteria 1887
164 nmdc:mga0yw44_3383_c1 3300050492 Bacteria 7076
165 nmdc:mga0yw44_78178_c1 3300050492 Bacteria 2069
166 nmdc:mga06z11_210842_c1 3300050494 Bacteria 1132
167 nmdc:mga06z11_7615_c1 3300050494 Bacteria 4469
168 nmdc:mga07m45_60253_c1 3300050496 Bacteria 2148
169 nmdc:mga05p37_81161_c1 3300050507 Bacteria 3994
170 nmdc:mga0qj67_1570_c1 3300050509 Bacteria 16051
171 nmdc:mga06r32_1224_c1 3300050510 Bacteria 23147
172 nmdc:mga0sz30_107106_c1 3300050516 Bacteria 1223
173 Ga0500610_0013695 3300053079 Bacteria 3785
174 Ga0500644_0081255 3300053088 Bacteria 1192
175 Ga0500556_0009762 3300053104 Bacteria 2798
176 Ga0500556_0093760 3300053104 Bacteria 1149
177 Ga0500562_009396 3300053108 Bacteria 2473
178 Ga0500658_0095693 3300053134 Bacteria 1290
179 Ga0500577_0135650 3300053142 Bacteria 1035
180 Ga0500588_0273411 3300053146 Bacteria 637
181 Ga0500616_0116961 3300053153 Bacteria 1279
182 Ga0500627_0014894 3300053158 Bacteria 2990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0219678 Ga0495582_0219678_22_390 122
2 3300046531 Ga0495665_0377040 Ga0495665_0377040_50_418 122
3 3300053134 Ga0500658_0095693 Ga0500658_0095693_12_389 124
4 3300046461 Ga0495641_0059390 Ga0495641_0059390_213_620 126
5 3300046475 Ga0495639_0050719 Ga0495639_0050719_917_1324 126
6 3300046514 Ga0495618_0496951 Ga0495618_0496951_91_498 126
7 3300046533 Ga0495640_0521072 Ga0495640_0521072_124_531 126
8 3300047319 Ga0495674_0449326 Ga0495674_0449326_363_770 126
9 iso_pu_bacteria 2643221715 2644639262 127
10 iso_pu_bacteria 2902810491 2902816096 127
11 3300006051 Ga0075364_10001085 Ga0075364_100010852 131
12 3300006186 Ga0075369_10337403 Ga0075369_103374032 131
13 3300031852 Ga0307410_10668867 Ga0307410_106688671 131
14 3300031995 Ga0307409_100938086 Ga0307409_1009380862 131
15 3300032004 Ga0307414_10522554 Ga0307414_105225542 131
16 3300041410 Ga0439461_0036975 Ga0439461_0036975_149_544 131
17 3300041411 Ga0439466_0008805 Ga0439466_0008805_1042_1437 131
18 3300041413 Ga0439465_0050184 Ga0439465_0050184_487_882 131
19 3300041997 Ga0439431_0006173 Ga0439431_0006173_287_682 131
20 3300042004 Ga0439445_0012537 Ga0439445_0012537_979_1374 131
21 3300042156 Ga0439446_0131630 Ga0439446_0131630_377_772 131
22 3300042435 Ga0439434_0001954 Ga0439434_0001954_1783_2178 131
23 3300050491 nmdc:mga00v17_29172_c1 nmdc:mga00v17_29172_c1_1474_1869 131
24 3300026088 Ga0207641_11398326 Ga0207641_113983262 132
25 iso_pu_bacteria 2902799365 2902802344 132
26 3300005466 Ga0070685_10638250 Ga0070685_106382502 133
27 3300006038 Ga0075365_10002619 Ga0075365_1000261910 133
28 3300006048 Ga0075363_100001275 Ga0075363_1000012752 133
29 3300006048 Ga0075363_100035832 Ga0075363_1000358324 133
30 3300006048 Ga0075363_100052022 Ga0075363_1000520223 133
31 3300006048 Ga0075363_100060115 Ga0075363_1000601152 133
32 3300006051 Ga0075364_10013928 Ga0075364_100139283 133
33 3300006051 Ga0075364_10043810 Ga0075364_100438102 133
34 3300006051 Ga0075364_10436309 Ga0075364_104363092 133
35 3300006177 Ga0075362_10017486 Ga0075362_100174863 133
36 3300006178 Ga0075367_10241465 Ga0075367_102414652 133
37 3300006186 Ga0075369_10163671 Ga0075369_101636712 133
38 3300006353 Ga0075370_10000831 Ga0075370_100008318 133
39 3300031995 Ga0307409_100497667 Ga0307409_1004976672 133
40 3300032005 Ga0307411_10741190 Ga0307411_107411902 133
41 3300032005 Ga0307411_10890753 Ga0307411_108907532 133
42 3300050490 nmdc:mga03n38_19553_c1 nmdc:mga03n38_19553_c1_1986_2390 133
43 3300050490 nmdc:mga03n38_4432_c1 nmdc:mga03n38_4432_c1_3087_3491 133
44 3300050490 nmdc:mga03n38_69731_c1 nmdc:mga03n38_69731_c1_1104_1508 133
45 3300050490 nmdc:mga03n38_7578_c1 nmdc:mga03n38_7578_c1_891_1295 133
46 3300050491 nmdc:mga00v17_147999_c1 nmdc:mga00v17_147999_c1_313_717 133
47 3300050491 nmdc:mga00v17_77137_c1 nmdc:mga00v17_77137_c1_751_1155 133
48 3300050491 nmdc:mga00v17_93866_c1 nmdc:mga00v17_93866_c1_574_978 133
49 3300050492 nmdc:mga0yw44_78178_c1 nmdc:mga0yw44_78178_c1_31_435 133
50 3300050494 nmdc:mga06z11_210842_c1 nmdc:mga06z11_210842_c1_585_989 133
51 3300050496 nmdc:mga07m45_60253_c1 nmdc:mga07m45_60253_c1_1587_1991 133
52 3300005937 Ga0081455_10107770 Ga0081455_101077701 136
53 3300005937 Ga0081455_10343711 Ga0081455_103437112 136
54 3300006177 Ga0075362_10717676 Ga0075362_107176761 136
55 3300044683 Ga0466965_0046041 Ga0466965_0046041_175_585 136
56 3300044683 Ga0466965_0086871 Ga0466965_0086871_923_1336 136
57 3300044735 Ga0466968_0033607 Ga0466968_0033607_1307_1720 136
58 3300044901 Ga0466960_0000859 Ga0466960_0000859_9262_9672 136
59 3300045976 Ga0466967_0017766 Ga0466967_0017766_1204_1638 136
60 3300046460 Ga0495638_0098425 Ga0495638_0098425_409_837 136
61 3300046524 Ga0495648_0001992 Ga0495648_0001992_6874_7314 136
62 3300046530 Ga0495654_0049547 Ga0495654_0049547_1521_1961 136
63 3300046648 Ga0495611_0082341 Ga0495611_0082341_646_1086 136
64 3300047320 Ga0495672_0001245 Ga0495672_0001245_21230_21670 136
65 3300047320 Ga0495672_0060668 Ga0495672_0060668_1576_2004 136
66 3300047320 Ga0495672_0082777 Ga0495672_0082777_1316_1735 136
67 3300047469 Ga0495673_0001225 Ga0495673_0001225_13901_14341 136
68 3300050491 nmdc:mga00v17_254646_c1 nmdc:mga00v17_254646_c1_132_551 136
69 3300053158 Ga0500627_0014894 Ga0500627_0014894_301_729 136
70 iso_pu_bacteria 8001781756 8001785522 137
71 3300006038 Ga0075365_10011749 Ga0075365_100117495 138
72 3300006048 Ga0075363_100005859 Ga0075363_1000058594 138
73 3300006051 Ga0075364_10016139 Ga0075364_100161395 138
74 3300050490 nmdc:mga03n38_1445_c1 nmdc:mga03n38_1445_c1_5204_5623 138
75 3300050491 nmdc:mga00v17_16792_c1 nmdc:mga00v17_16792_c1_938_1357 138
76 3300050492 nmdc:mga0yw44_3383_c1 nmdc:mga0yw44_3383_c1_3010_3429 138
77 3300050494 nmdc:mga06z11_7615_c1 nmdc:mga06z11_7615_c1_287_706 138
78 3300005437 Ga0070710_10393224 Ga0070710_103932242 139
79 3300005437 Ga0070710_10597807 Ga0070710_105978072 139
80 3300005445 Ga0070708_100726867 Ga0070708_1007268672 139
81 3300006028 Ga0070717_10168756 Ga0070717_101687562 139
82 3300006163 Ga0070715_10289694 Ga0070715_102896942 139
83 3300006175 Ga0070712_100324208 Ga0070712_1003242082 139
84 3300006175 Ga0070712_100983498 Ga0070712_1009834981 139
85 3300006358 Ga0068871_100662368 Ga0068871_1006623682 139
86 3300006914 Ga0075436_100668837 Ga0075436_1006688372 139
87 3300025898 Ga0207692_10059708 Ga0207692_100597083 139
88 3300025906 Ga0207699_10187433 Ga0207699_101874332 139
89 3300025915 Ga0207693_10020967 Ga0207693_100209675 139
90 3300025915 Ga0207693_10940264 Ga0207693_109402641 139
91 3300035113 Ga0373936_0137431 Ga0373936_0137431_27_449 139
92 3300045976 Ga0466967_0008129 Ga0466967_0008129_4704_5153 139
93 3300046462 Ga0495651_0159894 Ga0495651_0159894_83_502 139
94 3300047322 Ga0495680_0568017 Ga0495680_0568017_205_627 139
95 3300048088 Ga0495602_0791830 Ga0495602_0791830_27_449 139
96 iso_pu_bacteria 2816332119 2816428181 139
97 3300005347 Ga0070668_100002321 Ga0070668_1000023218 140
98 3300005445 Ga0070708_100164283 Ga0070708_1001642833 140
99 3300005467 Ga0070706_100163656 Ga0070706_1001636562 140
100 3300005468 Ga0070707_100029657 Ga0070707_1000296574 140
101 3300005471 Ga0070698_100630465 Ga0070698_1006304651 140
102 3300005536 Ga0070697_100430533 Ga0070697_1004305332 140
103 3300006038 Ga0075365_10143039 Ga0075365_101430392 140
104 3300006175 Ga0070712_100678426 Ga0070712_1006784262 140
105 3300006186 Ga0075369_10042698 Ga0075369_100426983 140
106 3300009092 Ga0105250_10016603 Ga0105250_100166032 140
107 3300025910 Ga0207684_10030197 Ga0207684_100301972 140
108 3300025922 Ga0207646_10065272 Ga0207646_100652723 140
109 3300025972 Ga0207668_10007604 Ga0207668_100076048 140
110 3300031616 Ga0307508_10282022 Ga0307508_102820222 140
111 3300046460 Ga0495638_0001007 Ga0495638_0001007_27035_27487 140
112 3300046660 Ga0495625_0144724 Ga0495625_0144724_337_762 140
113 3300049574 Ga0501038_0129649 Ga0501038_0129649_1113_1544 140
114 3300050516 nmdc:mga0sz30_107106_c1 nmdc:mga0sz30_107106_c1_125_550 140
115 3300053079 Ga0500610_0013695 Ga0500610_0013695_2889_3314 140
116 3300053088 Ga0500644_0081255 Ga0500644_0081255_690_1115 140
117 3300053104 Ga0500556_0009762 Ga0500556_0009762_1164_1616 140
118 3300053104 Ga0500556_0093760 Ga0500556_0093760_228_653 140
119 3300053108 Ga0500562_009396 Ga0500562_009396_375_800 140
120 3300053142 Ga0500577_0135650 Ga0500577_0135650_230_682 140
121 3300053146 Ga0500588_0273411 Ga0500588_0273411_143_595 140
122 3300053153 Ga0500616_0116961 Ga0500616_0116961_301_726 140
123 3300025972 Ga0207668_10084876 Ga0207668_100848763 141
124 3300031730 Ga0307516_10231283 Ga0307516_102312832 141
125 3300032126 Ga0307415_101659837 Ga0307415_1016598372 141
126 iso_pu_bacteria 2775506925 2776374880 141
127 iso_pu_bacteria 2863067949 2863074831 141
128 3300046507 Ga0495606_0002644 Ga0495606_0002644_12704_13135 142
129 3300046616 Ga0495668_0000197 Ga0495668_0000197_5528_5959 142
130 3300046660 Ga0495625_0002368 Ga0495625_0002368_18020_18451 142
131 3300047323 Ga0495683_0091285 Ga0495683_0091285_606_1037 142
132 3300048091 Ga0495626_0000025 Ga0495626_0000025_63666_64097 142
133 3300037466 Ga0395898_0286692 Ga0395898_0286692_1062_1496 143
134 3300038443 Ga0395901_0242147 Ga0395901_0242147_1309_1743 143
135 3300005341 Ga0070691_10203022 Ga0070691_102030222 144
136 3300005347 Ga0070668_100270991 Ga0070668_1002709913 144
137 3300005356 Ga0070674_100657337 Ga0070674_1006573371 144
138 3300005435 Ga0070714_100163921 Ga0070714_1001639214 144
139 3300005445 Ga0070708_100034904 Ga0070708_1000349046 144
140 3300005458 Ga0070681_10593537 Ga0070681_105935371 144
141 3300005467 Ga0070706_100050468 Ga0070706_1000504685 144
142 3300005467 Ga0070706_100356360 Ga0070706_1003563602 144
143 3300005471 Ga0070698_101194893 Ga0070698_1011948931 144
144 3300005547 Ga0070693_100322460 Ga0070693_1003224602 144
145 3300005615 Ga0070702_100001893 Ga0070702_1000018938 144
146 3300005843 Ga0068860_100674359 Ga0068860_1006743592 144
147 3300006846 Ga0075430_100001965 Ga0075430_1000019659 144
148 3300006847 Ga0075431_100002849 Ga0075431_1000028498 144
149 3300006880 Ga0075429_100275360 Ga0075429_1002753603 144
150 3300007265 Ga0099794_10078526 Ga0099794_100785262 144
151 3300009093 Ga0105240_11121432 Ga0105240_111214321 144
152 3300009147 Ga0114129_10095971 Ga0114129_100959715 144
153 3300009148 Ga0105243_10032869 Ga0105243_100328694 144
154 3300009551 Ga0105238_10235297 Ga0105238_102352972 144
155 3300009553 Ga0105249_10872506 Ga0105249_108725061 144
156 3300010375 Ga0105239_10697617 Ga0105239_106976171 144
157 3300011119 Ga0105246_10686725 Ga0105246_106867252 144
158 3300013297 Ga0157378_10006649 Ga0157378_100066492 144
159 3300013306 Ga0163162_10228586 Ga0163162_102285862 144
160 3300013308 Ga0157375_10009103 Ga0157375_100091032 144
161 3300014969 Ga0157376_10626581 Ga0157376_106265812 144
162 3300025302 Ga0207426_1000495 Ga0207426_100049519 144
163 3300025910 Ga0207684_10024483 Ga0207684_100244836 144
164 3300025910 Ga0207684_10140104 Ga0207684_101401043 144
165 3300025912 Ga0207707_10516150 Ga0207707_105161502 144
166 3300025922 Ga0207646_10033352 Ga0207646_100333523 144
167 3300025922 Ga0207646_10169008 Ga0207646_101690082 144
168 3300025922 Ga0207646_10318357 Ga0207646_103183572 144
169 3300025934 Ga0207686_10171409 Ga0207686_101714092 144
170 3300025935 Ga0207709_10081893 Ga0207709_100818932 144
171 3300025938 Ga0207704_10625126 Ga0207704_106251261 144
172 3300025972 Ga0207668_10733034 Ga0207668_107330341 144
173 3300025981 Ga0207640_12146528 Ga0207640_121465281 144
174 3300026089 Ga0207648_10229870 Ga0207648_102298701 144
175 3300026121 Ga0207683_10432928 Ga0207683_104329282 144
176 3300028381 Ga0268264_10033487 Ga0268264_100334872 144
177 3300030522 Ga0307512_10003136 Ga0307512_1000313611 144
178 3300031456 Ga0307513_10203213 Ga0307513_102032132 144
179 3300031616 Ga0307508_10160034 Ga0307508_101600342 144
180 3300031730 Ga0307516_10980648 Ga0307516_109806481 144
181 3300031824 Ga0307413_10303198 Ga0307413_103031981 144
182 3300031852 Ga0307410_10097760 Ga0307410_100977602 144
183 3300031911 Ga0307412_10101013 Ga0307412_101010134 144
184 3300037466 Ga0395898_0003192 Ga0395898_0003192_17662_18108 144
185 3300041443 Ga0451789_0423546 Ga0451789_0423546_117_554 144
186 3300046517 Ga0495630_0867402 Ga0495630_0867402_150_593 144
187 3300050507 nmdc:mga05p37_81161_c1 nmdc:mga05p37_81161_c1_1831_2292 144
188 3300050509 nmdc:mga0qj67_1570_c1 nmdc:mga0qj67_1570_c1_11861_12322 144
189 3300050510 nmdc:mga06r32_1224_c1 nmdc:mga06r32_1224_c1_12034_12495 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

42

116

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.8943 38 114
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8476 21 119
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8345 38 114
2phd-assembly1.cif.gz_A crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8339 38 114
4e4h-assembly1.cif.gz_C crystal structure of histone demethylase no66 0.8284 35 114
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8943 38 114 2.60.120.10
af_P15590_92_287_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8331 38 122 2.60.120.10
4e4hC01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8284 35 114 2.60.120.650
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8225 38 127 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8165 38 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1H5IB18-F1-model_v4 Cupin domain-containing protein 0.99 40 144
AF-A0A4U3LJR7-F1-model_v4 Cupin domain-containing protein 0.9805 39 140
AF-W2EVK5-F1-model_v4 Cupin 0.9714 39 144
AF-A0A4U3LJR7-F1-model_v4 Cupin domain-containing protein 0.9711 39 140
AF-A0A2S9GNZ8-F1-model_v4 Cupin 0.9663 51 125

Feature Viewer

pLDDT pTM Quality
87.82 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map