F290933

General Info

Members Datasets Scaffolds Average Seq Length
189 119 378 317

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10031894|Ga0157371_100318942
Length 339
Sequence MAKQAICFLFGQTQSLSPLKHQPMPTTTKPTFWKRTGVQDWFLKKETSYTETVSMTPDLVYKYIIEKFKDSIAELSFADRIIFYHEYIICFSPPDYNKFMDNNRGIFSLIVKESVKAFYQILQEYRRKGKKVTASSNKWVFRFVSHPDYEKGDKSFIGKLLPGKVHRGEENLRVTFIPRQTGIAQTFDINDEILKDFTYYSDGYYEIPWNGNLVPADVNEVSQPRYFARMEATLPEKEYAGKKLEYLIKEENFLICGTDEKPDRPAVFRIPSEWVSTPHLSVRYDRTADKFYIASFGEKTLVNENEVTKSYPDSPVWTVLPLNSRIVLNGIVSINLFKV

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
89 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
90 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
91 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
92 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
93 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
94 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
95 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
96 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
97 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
98 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
99 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
100 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
101 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
102 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
103 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
104 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
105 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
111 2739367651 Pedobacter sp. OK291 Isolate Unclassified
112 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
113 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
114 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
115 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
116 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
117 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
118 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
119 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 0
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 17.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10031894 3300013102 Bacteria 3794
2 SwRhRL2b_contig_3312534 2162886007 Bacteria 3410
3 rootH2_10150227 3300003320 Unclassified 3918
4 Ga0065714_10005649 3300005288 Bacteria 4959
5 Ga0065704_10000212 3300005289 Bacteria 87819
6 Ga0065704_10107237 3300005289 Bacteria 2031
7 Ga0070658_10255698 3300005327 Bacteria 1486
8 Ga0070683_100101438 3300005329 Bacteria 2710
9 Ga0070677_10029038 3300005333 Bacteria 2094
10 Ga0070666_10225223 3300005335 Bacteria 1323
11 Ga0070680_100030982 3300005336 Bacteria 4298
12 Ga0070682_100026991 3300005337 Bacteria 3443
13 Ga0070675_100138070 3300005354 Bacteria 2082
14 Ga0070688_100046782 3300005365 Bacteria 2681
15 Ga0070688_100143393 3300005365 Bacteria 1625
16 Ga0070659_100033658 3300005366 Bacteria 3982
17 Ga0070667_100158376 3300005367 Bacteria 1993
18 Ga0070663_100024584 3300005455 Bacteria 4057
19 Ga0070678_100170481 3300005456 Bacteria 1772
20 Ga0070681_10105613 3300005458 Unclassified 2758
21 Ga0070681_10116261 3300005458 Bacteria 2612
22 Ga0070685_10156753 3300005466 Bacteria 1448
23 Ga0070685_10212623 3300005466 Bacteria 1263
24 Ga0070679_100016934 3300005530 Bacteria 7046
25 Ga0070679_100032590 3300005530 Bacteria 5155
26 Ga0070679_100048310 3300005530 Bacteria 4240
27 Ga0070679_100118239 3300005530 Bacteria 2635
28 Ga0070684_100058858 3300005535 Bacteria 3359
29 Ga0070684_100288501 3300005535 Bacteria 1504
30 Ga0068853_100040339 3300005539 Bacteria 3983
31 Ga0068853_100111270 3300005539 Bacteria 2433
32 Ga0068855_100000019 3300005563 Bacteria 205963
33 Ga0068855_100000057 3300005563 Bacteria 134898
34 Ga0068855_100043440 3300005563 Bacteria 5324
35 Ga0068855_100093177 3300005563 Unclassified 3474
36 Ga0068855_100129543 3300005563 Bacteria 2882
37 Ga0068855_100161428 3300005563 Bacteria 2543
38 Ga0068854_100035917 3300005578 Unclassified 3472
39 Ga0068856_100000204 3300005614 Bacteria 63335
40 Ga0068856_100009387 3300005614 Bacteria 9501
41 Ga0068856_100551618 3300005614 Unclassified 1174
42 Ga0068852_100010496 3300005616 Bacteria 6925
43 Ga0068852_100018251 3300005616 Bacteria 5525
44 Ga0068862_100007578 3300005844 Bacteria 8998
45 Ga0097621_100121841 3300006237 Bacteria 2212
46 Ga0068871_100115506 3300006358 Bacteria 2262
47 Ga0105240_10073205 3300009093 Bacteria 4231
48 Ga0105241_10001049 3300009174 Bacteria 21064
49 Ga0105249_10381740 3300009553 Bacteria 1435
50 Ga0105239_10004248 3300010375 Bacteria 17202
51 Ga0157373_10000287 3300013100 Bacteria 40438
52 Ga0157373_10014444 3300013100 Bacteria 5788
53 Ga0157371_10000274 3300013102 Bacteria 69782
54 Ga0157371_10000798 3300013102 Bacteria 36143
55 Ga0157371_10034110 3300013102 Bacteria 3652
56 Ga0157371_10040359 3300013102 Unclassified 3334
57 Ga0157371_10061026 3300013102 Bacteria 2674
58 Ga0157371_10073807 3300013102 Bacteria 2416
59 Ga0157371_10159686 3300013102 Bacteria 1610
60 Ga0157370_10020778 3300013104 Bacteria 6551
61 Ga0157370_10142657 3300013104 Unclassified 2232
62 Ga0157370_10378588 3300013104 Bacteria 1304
63 Ga0157369_10000007 3300013105 Bacteria 402562
64 Ga0157369_10026357 3300013105 Bacteria 6448
65 Ga0157369_10088895 3300013105 Bacteria 3298
66 Ga0157369_10388605 3300013105 Bacteria 1448
67 Ga0157374_10367506 3300013296 Bacteria 1431
68 Ga0157378_10010436 3300013297 Bacteria 8112
69 Ga0163162_10061830 3300013306 Bacteria 3783
70 Ga0163162_10083780 3300013306 Bacteria 3263
71 Ga0163162_10387773 3300013306 Bacteria 1530
72 Ga0157372_10021991 3300013307 Bacteria 6895
73 Ga0157372_10060803 3300013307 Bacteria 4227
74 Ga0157372_10100298 3300013307 Bacteria 3304
75 Ga0157372_10114461 3300013307 Bacteria 3092
76 Ga0157372_10171348 3300013307 Unclassified 2511
77 Ga0157372_10205262 3300013307 Bacteria 2283
78 Ga0157372_10239692 3300013307 Unclassified 2104
79 Ga0157372_10326303 3300013307 Bacteria 1787
80 Ga0157375_10069559 3300013308 Bacteria 3527
81 Ga0157375_10247171 3300013308 Bacteria 1944
82 Ga0157380_10060463 3300014326 Bacteria 3028
83 Ga0182006_1000233 3300015261 Bacteria 52709
84 Ga0182007_10000007 3300015262 Bacteria 376596
85 Ga0163161_10000130 3300017792 Bacteria 70533
86 Ga0163161_10000686 3300017792 Bacteria 27033
87 Ga0163161_10100654 3300017792 Bacteria 2151
88 Ga0213876_10039426 3300021384 Bacteria 2496
89 Ga0207647_10123023 3300025904 Bacteria 1529
90 Ga0207654_10080230 3300025911 Bacteria 1962
91 Ga0207707_10091285 3300025912 Bacteria 2662
92 Ga0207695_10010727 3300025913 Bacteria 11181
93 Ga0207671_10016134 3300025914 Bacteria 5818
94 Ga0207660_10061364 3300025917 Unclassified 2706
95 Ga0207662_10170269 3300025918 Unclassified 1396
96 Ga0207657_10059288 3300025919 Bacteria 3290
97 Ga0207657_10061392 3300025919 Unclassified 3223
98 Ga0207652_10000278 3300025921 Bacteria 53117
99 Ga0207652_10006766 3300025921 Bacteria 9245
100 Ga0207652_10052326 3300025921 Bacteria 3504
101 Ga0207652_10129365 3300025921 Bacteria 2251
102 Ga0207659_10060061 3300025926 Bacteria 2735
103 Ga0207690_10018019 3300025932 Bacteria 4325
104 Ga0207690_10059542 3300025932 Bacteria 2588
105 Ga0207691_10140568 3300025940 Bacteria 2128
106 Ga0207691_10432211 3300025940 Unclassified 1121
107 Ga0207661_10258880 3300025944 Bacteria 1549
108 Ga0207667_10000178 3300025949 Bacteria 92346
109 Ga0207667_10127480 3300025949 Bacteria 2622
110 Ga0207667_10211986 3300025949 Unclassified 1985
111 Ga0207667_10299079 3300025949 Bacteria 1644
112 Ga0207712_10322352 3300025961 Unclassified 1275
113 Ga0207640_10005284 3300025981 Bacteria 7034
114 Ga0207640_10352634 3300025981 Unclassified 1183
115 Ga0207678_10076195 3300026067 Unclassified 2873
116 Ga0207702_10005206 3300026078 Bacteria 11422
117 Ga0207702_10017185 3300026078 Bacteria 5985
118 Ga0207702_10114982 3300026078 Bacteria 2399
119 Ga0207702_10244601 3300026078 Unclassified 1682
120 Ga0207702_10446239 3300026078 Unclassified 1255
121 Ga0207648_10097168 3300026089 Bacteria 2578
122 Ga0207676_10112191 3300026095 Unclassified 2284
123 Ga0207676_10482858 3300026095 Bacteria 1174
124 Ga0207674_10046103 3300026116 Unclassified 4478
125 Ga0207698_10075105 3300026142 Bacteria 2700
126 Ga0207698_10294208 3300026142 Bacteria 1508
127 Ga0207698_10378215 3300026142 Unclassified 1346
128 Ga0307408_100085571 3300031548 Bacteria 2368
129 Ga0307405_10000037 3300031731 Bacteria 91045
130 Ga0307405_10130376 3300031731 Bacteria 1736
131 Ga0307407_10000025 3300031903 Bacteria 112811
132 Ga0307407_10018522 3300031903 Bacteria 3524
133 Ga0307412_10000030 3300031911 Bacteria 208541
134 Ga0307409_100010532 3300031995 Bacteria 5757
135 Ga0307416_100000080 3300032002 Bacteria 70510
136 Ga0307414_10012926 3300032004 Bacteria 4956
137 Ga0307414_10043170 3300032004 Bacteria 3069
138 Ga0395899_0000034 3300037312 Bacteria 302623
139 Ga0395899_0040895 3300037312 Unclassified 3466
140 Ga0395900_0083731 3300037418 Bacteria 3277
141 Ga0395898_0108826 3300037466 Unclassified 2657
142 Ga0395905_0001101 3300037471 Bacteria 33997
143 Ga0395901_0289241 3300038443 Unclassified 1701
144 Ga0436365_0367325 3300039437 Bacteria 3298
145 Ga0439449_0001502 3300042007 Bacteria 9133
146 Ga0439462_0035887 3300042015 Bacteria 1319
147 Ga0495645_0053064 3300046543 Bacteria 2948
148 Ga0495661_0000451 3300046665 Bacteria 43473
149 Ga0495661_0068817 3300046665 Bacteria 2076
150 Ga0495674_0408035 3300047319 Bacteria 1096
151 Ga0495672_0023915 3300047320 Bacteria 3947
152 Ga0501298_004584 3300049521 Unclassified 2184
153 Ga0501198_010408 3300049649 Bacteria 1375
154 Ga0501202_000467 3300049652 Bacteria 5752
155 Ga0501202_005826 3300049652 Bacteria 2189
156 Ga0501202_014305 3300049652 Unclassified 1519
157 Ga0501216_004583 3300049660 Unclassified 2056
158 Ga0501217_016888 3300049661 Bacteria 1677
159 Ga0501222_004274 3300049662 Bacteria 1941
160 Ga0501223_003355 3300049663 Bacteria 3495
161 Ga0501223_003996 3300049663 Bacteria 3176
162 Ga0501224_005578 3300049664 Bacteria 1807
163 Ga0501233_004020 3300049668 Unclassified 2672
164 Ga0501235_000615 3300049669 Bacteria 7180
165 Ga0501242_001460 3300049674 Unclassified 2377
166 Ga0501243_000302 3300049675 Bacteria 6376
167 Ga0501243_002552 3300049675 Unclassified 2676
168 Ga0501250_000992 3300049680 Unclassified 2173
169 Ga0501252_003051 3300049682 Bacteria 1704
170 Ga0501259_000424 3300049688 Bacteria 6719
171 Ga0501259_001295 3300049688 Bacteria 4183
172 Ga0501234_000472 3300049707 Bacteria 6154
173 Ga0501245_006540 3300049708 Bacteria 1632
174 Ga0501268_005910 3300049765 Bacteria 1775
175 Ga0501044_0129447 3300049823 Unclassified 2519
176 Ga0501044_0406716 3300049823 Unclassified 1273
177 Ga0501212_002011 3300049851 Bacteria 2400
178 Ga0500635_0000380 3300053080 Bacteria 13730
179 Ga0500651_0031242 3300053093 Bacteria 3353
180 2586208758 2585427687 Bacteria 5544917
181 2739590284 2739367651 Bacteria 6359826
182 2776614974 2775506987 Bacteria 5373360
183 2842725510 2842722452 Bacteria 6263924
184 2842914655 2842909656 Bacteria 6185908
185 2852623251 2852623160 Bacteria 4376875
186 2857628657 2857627736 Bacteria 5625397
187 2884937880 2884933994 Bacteria 4535041
188 2946002497 2945997725 Bacteria 6404843
189 2954019361 2954016120 Bacteria 6446024
190 Ga0157371_10031894
191 SwRhRL2b_contig_3312534
192 rootH2_10150227
193 Ga0065714_10005649
194 Ga0065704_10000212
195 Ga0065704_10107237
196 Ga0070658_10255698
197 Ga0070683_100101438
198 Ga0070677_10029038
199 Ga0070666_10225223
200 Ga0070680_100030982
201 Ga0070682_100026991
202 Ga0070675_100138070
203 Ga0070688_100046782
204 Ga0070688_100143393
205 Ga0070659_100033658
206 Ga0070667_100158376
207 Ga0070663_100024584
208 Ga0070678_100170481
209 Ga0070681_10105613
210 Ga0070681_10116261
211 Ga0070685_10156753
212 Ga0070685_10212623
213 Ga0070679_100016934
214 Ga0070679_100032590
215 Ga0070679_100048310
216 Ga0070679_100118239
217 Ga0070684_100058858
218 Ga0070684_100288501
219 Ga0068853_100040339
220 Ga0068853_100111270
221 Ga0068855_100000019
222 Ga0068855_100000057
223 Ga0068855_100043440
224 Ga0068855_100093177
225 Ga0068855_100129543
226 Ga0068855_100161428
227 Ga0068854_100035917
228 Ga0068856_100000204
229 Ga0068856_100009387
230 Ga0068856_100551618
231 Ga0068852_100010496
232 Ga0068852_100018251
233 Ga0068862_100007578
234 Ga0097621_100121841
235 Ga0068871_100115506
236 Ga0105240_10073205
237 Ga0105241_10001049
238 Ga0105249_10381740
239 Ga0105239_10004248
240 Ga0157373_10000287
241 Ga0157373_10014444
242 Ga0157371_10000274
243 Ga0157371_10000798
244 Ga0157371_10034110
245 Ga0157371_10040359
246 Ga0157371_10061026
247 Ga0157371_10073807
248 Ga0157371_10159686
249 Ga0157370_10020778
250 Ga0157370_10142657
251 Ga0157370_10378588
252 Ga0157369_10000007
253 Ga0157369_10026357
254 Ga0157369_10088895
255 Ga0157369_10388605
256 Ga0157374_10367506
257 Ga0157378_10010436
258 Ga0163162_10061830
259 Ga0163162_10083780
260 Ga0163162_10387773
261 Ga0157372_10021991
262 Ga0157372_10060803
263 Ga0157372_10100298
264 Ga0157372_10114461
265 Ga0157372_10171348
266 Ga0157372_10205262
267 Ga0157372_10239692
268 Ga0157372_10326303
269 Ga0157375_10069559
270 Ga0157375_10247171
271 Ga0157380_10060463
272 Ga0182006_1000233
273 Ga0182007_10000007
274 Ga0163161_10000130
275 Ga0163161_10000686
276 Ga0163161_10100654
277 Ga0213876_10039426
278 Ga0207647_10123023
279 Ga0207654_10080230
280 Ga0207707_10091285
281 Ga0207695_10010727
282 Ga0207671_10016134
283 Ga0207660_10061364
284 Ga0207662_10170269
285 Ga0207657_10059288
286 Ga0207657_10061392
287 Ga0207652_10000278
288 Ga0207652_10006766
289 Ga0207652_10052326
290 Ga0207652_10129365
291 Ga0207659_10060061
292 Ga0207690_10018019
293 Ga0207690_10059542
294 Ga0207691_10140568
295 Ga0207691_10432211
296 Ga0207661_10258880
297 Ga0207667_10000178
298 Ga0207667_10127480
299 Ga0207667_10211986
300 Ga0207667_10299079
301 Ga0207712_10322352
302 Ga0207640_10005284
303 Ga0207640_10352634
304 Ga0207678_10076195
305 Ga0207702_10005206
306 Ga0207702_10017185
307 Ga0207702_10114982
308 Ga0207702_10244601
309 Ga0207702_10446239
310 Ga0207648_10097168
311 Ga0207676_10112191
312 Ga0207676_10482858
313 Ga0207674_10046103
314 Ga0207698_10075105
315 Ga0207698_10294208
316 Ga0207698_10378215
317 Ga0307408_100085571
318 Ga0307405_10000037
319 Ga0307405_10130376
320 Ga0307407_10000025
321 Ga0307407_10018522
322 Ga0307412_10000030
323 Ga0307409_100010532
324 Ga0307416_100000080
325 Ga0307414_10012926
326 Ga0307414_10043170
327 Ga0395899_0000034
328 Ga0395899_0040895
329 Ga0395900_0083731
330 Ga0395898_0108826
331 Ga0395905_0001101
332 Ga0395901_0289241
333 Ga0436365_0367325
334 Ga0439449_0001502
335 Ga0439462_0035887
336 Ga0495645_0053064
337 Ga0495661_0000451
338 Ga0495661_0068817
339 Ga0495674_0408035
340 Ga0495672_0023915
341 Ga0501298_004584
342 Ga0501198_010408
343 Ga0501202_000467
344 Ga0501202_005826
345 Ga0501202_014305
346 Ga0501216_004583
347 Ga0501217_016888
348 Ga0501222_004274
349 Ga0501223_003355
350 Ga0501223_003996
351 Ga0501224_005578
352 Ga0501233_004020
353 Ga0501235_000615
354 Ga0501242_001460
355 Ga0501243_000302
356 Ga0501243_002552
357 Ga0501250_000992
358 Ga0501252_003051
359 Ga0501259_000424
360 Ga0501259_001295
361 Ga0501234_000472
362 Ga0501245_006540
363 Ga0501268_005910
364 Ga0501044_0129447
365 Ga0501044_0406716
366 Ga0501212_002011
367 Ga0500635_0000380
368 Ga0500651_0031242
369 2586208758
370 2739590284
371 2776614974
372 2842725510
373 2842914655
374 2852623251
375 2857628657
376 2884937880
377 2946002497
378 2954019361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3unm-assembly1.cif.gz_A crystal structure of the human mdc1 fha domain 0.8184 204 316
5djo-assembly1.cif.gz_A crystal structure of the cc1-fha tandem of kinesin-3 kif13a 0.8034 203 316
3va1-assembly1.cif.gz_B crystal structure of the mammalian mdc1 fha domain 0.8034 204 316
3unm-assembly1.cif.gz_A crystal structure of the human mdc1 fha domain 0.7965 204 316
6hc0-assembly3.cif.gz_C bdellovibrio bacteriovorus dgcb fha domain, tail complex 0.7926 203 316
ID Description Score Start End Superfamily
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7969 204 314 2.60.200.20
af_P85037_82_205_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7922 195 315 2.60.200.20
af_D3ZU55_1_85_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7792 225 315 2.60.200.20
af_A0A286Y8S4_1_94_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7756 217 306 2.60.200.20
af_D3ZU55_1_85_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7713 225 315 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7V3UNT0-F1-model_v4 FHA domain-containing protein 0.8546 201 314
AF-A0A7K1JDD1-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.8528 227 309 GO:0004016
GO:0009190
GO:0035556
AF-A0A078AKJ3-F1-model_v4 Fork head transcription factor 1 0.8373 202 316 GO:0005634
GO:0043565
GO:0060962
AF-A0A1X7VN00-F1-model_v4 FHA domain-containing protein 0.826 203 314 GO:0005524
GO:0005874
AF-A0A353Z7Y2-F1-model_v4 FHA domain-containing protein 0.8237 203 316

Map