F290828

General Info

Members Datasets Scaffolds Average Seq Length
189 126 378 302

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10032662|Ga0105240_100326623
Length 330
Sequence LDLFLRTIDVDQLNFHHLLYFWRVAKAGHLTRVASELHVSQSALSNQIRQLEERLGEALFERTGRRLVLTETGQLVQSYAENIFGLGQELLGRLQGSREGMVRLRVGSVATMSRNYQENWIRPLLADPAVTLTLESGMLEDLMDRLLQHQLDVVLANEAVPTVPDRPLHCLFLGSQEISLVGPKNVWHKRTLRLPDDLDGLDLALPGPRHAVRAKFDALCVAAGVAPRVRAEVDDMAMLRLVARDSGWLTMLPEVVVQDELRSGVLVTVGRSKQLQESFYAITTLHRHRIERLDQLLARQPSRKRKPGRGTSQADPASSKKIRSEGHGSR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
32 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
65 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
99 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
100 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
101 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
102 2643221629 Devosia sp. Root105 Isolate Unclassified
103 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
104 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
105 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
106 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
107 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
108 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
109 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
110 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
111 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
112 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
113 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
114 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
115 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
116 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
117 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
118 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
119 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
120 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
121 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
122 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
123 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
124 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
125 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
126 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.66
Metatranscriptomes 0
Isolates 15.34

Biome Distribution

Category Percentage (%)
Aerial Root 1.06
Bulb 0
Endosphere 7.94
Nodule 0
Rhizoplane 1.59
Rhizosphere 77.25
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10032662 3300009093 Bacteria 6736
2 JGI24739J22299_10018140 3300001989 Bacteria 2532
3 JGI25155J39150_1000100 3300002704 Bacteria 46616
4 JGI25156J39149_1000179 3300002705 Bacteria 46616
5 JGI25156J39149_1001406 3300002705 Bacteria 10253
6 JGI25154J39366_1000186 3300002738 Bacteria 46616
7 JGI25157J39369_1000220 3300002741 Bacteria 46616
8 Ga0055538_1000119 3300003751 Bacteria 60124
9 Ga0055539_1000164 3300003752 Bacteria 60124
10 Ga0055533_1000168 3300003756 Bacteria 60124
11 Ga0055525_1000228 3300003759 Bacteria 60124
12 Ga0055529_1001069 3300003763 Bacteria 12694
13 Ga0055541_1000111 3300003841 Bacteria 60124
14 Ga0068853_100074900 3300005539 Bacteria 2954
15 Ga0068855_100018394 3300005563 Bacteria 8395
16 Ga0068855_100106005 3300005563 Bacteria 3231
17 Ga0068855_100340015 3300005563 Bacteria 1655
18 Ga0068854_100024556 3300005578 Bacteria 4128
19 Ga0070717_10031086 3300006028 Bacteria 4293
20 Ga0105251_10002080 3300009011 Bacteria 16161
21 Ga0105244_10006824 3300009036 Bacteria 7340
22 Ga0105244_10035879 3300009036 Bacteria 2602
23 Ga0105240_10037014 3300009093 Bacteria 6273
24 Ga0105240_10064235 3300009093 Bacteria 4562
25 Ga0105240_10073738 3300009093 Unclassified 4214
26 Ga0105247_10000657 3300009101 Bacteria 27446
27 Ga0105242_10005718 3300009176 Bacteria 9590
28 Ga0105237_10451127 3300009545 Bacteria 1292
29 Ga0105238_10052650 3300009551 Bacteria 4092
30 Ga0105148_100593 3300009978 Bacteria 3022
31 Ga0105239_10442112 3300010375 Unclassified 1474
32 Ga0157373_10012538 3300013100 Bacteria 6231
33 Ga0157373_10014243 3300013100 Bacteria 5833
34 Ga0157371_10012908 3300013102 Bacteria 6361
35 Ga0157370_10000699 3300013104 Bacteria 41929
36 Ga0157369_10011839 3300013105 Bacteria 9910
37 Ga0182006_1000626 3300015261 Bacteria 25233
38 Ga0213872_10000055 3300021361 Bacteria 101489
39 Ga0213872_10002347 3300021361 Bacteria 11242
40 Ga0213872_10011608 3300021361 Bacteria 4165
41 Ga0213872_10167354 3300021361 Bacteria 954
42 Ga0209435_100034 3300025206 Bacteria 144486
43 Ga0209784_100018 3300025224 Bacteria 456816
44 Ga0209566_100016 3300025225 Bacteria 456824
45 Ga0209674_100030 3300025226 Bacteria 456824
46 Ga0209672_101843 3300025228 Bacteria 6376
47 Ga0209563_100034 3300025230 Bacteria 456824
48 Ga0209258_100294 3300025242 Bacteria 82196
49 Ga0209646_1000118 3300025246 Bacteria 149446
50 Ga0209026_1000106 3300025250 Bacteria 149446
51 Ga0209677_100019 3300025253 Bacteria 456824
52 Ga0209759_1000455 3300025256 Bacteria 46668
53 Ga0209759_1001084 3300025256 Bacteria 17719
54 Ga0209455_1000589 3300025272 Bacteria 23557
55 Ga0209455_1017420 3300025272 Bacteria 1506
56 Ga0207655_1012711 3300025728 Bacteria 4894
57 Ga0207713_1029488 3300025735 Bacteria 2456
58 Ga0207710_10000642 3300025900 Bacteria 19828
59 Ga0207695_10000377 3300025913 Bacteria 101452
60 Ga0207695_10022920 3300025913 Bacteria 7073
61 Ga0207695_10027883 3300025913 Bacteria 6278
62 Ga0207695_10048529 3300025913 Bacteria 4483
63 Ga0207694_10041037 3300025924 Bacteria 3565
64 Ga0207694_10069991 3300025924 Unclassified 2741
65 Ga0207667_10000036 3300025949 Bacteria 297966
66 Ga0207667_10020282 3300025949 Bacteria 7398
67 Ga0207640_10005936 3300025981 Bacteria 6667
68 Ga0207639_10072408 3300026041 Bacteria 2698
69 Ga0265327_10000058 3300031251 Bacteria 237043
70 Ga0316575_10051159 3300031665 Bacteria 1645
71 Ga0316576_10102889 3300031727 Unclassified 2136
72 Ga0316576_10121705 3300031727 Bacteria 1960
73 Ga0316576_10176917 3300031727 Bacteria 1610
74 Ga0316576_10257954 3300031727 Bacteria 1308
75 Ga0316578_10059537 3300031728 Bacteria 2247
76 Ga0316580_10027646 3300032139 Bacteria 1753
77 Ga0316574_0033488 3300035398 Bacteria 3128
78 Ga0316574_0125479 3300035398 Bacteria 1650
79 Ga0316574_0128584 3300035398 Bacteria 1629
80 Ga0316582_0059922 3300036647 Bacteria 2439
81 Ga0316584_0286572 3300036712 Bacteria 1195
82 Ga0395899_0000506 3300037312 Bacteria 43276
83 Ga0395899_0228362 3300037312 Bacteria 1286
84 Ga0395900_0008850 3300037418 Bacteria 10335
85 Ga0395900_0127251 3300037418 Bacteria 2612
86 Ga0395900_0236078 3300037418 Bacteria 1836
87 Ga0395898_0307982 3300037466 Bacteria 1511
88 Ga0395901_0019811 3300038443 Bacteria 6881
89 Ga0395901_0412494 3300038443 Bacteria 1386
90 Ga0436361_0149060 3300039447 Bacteria 17044
91 Ga0436361_0149866 3300039447 Bacteria 10533
92 Ga0436361_0305518 3300039447 Bacteria 51549
93 Ga0436361_0749269 3300039447 Bacteria 121408
94 Ga0436361_1080012 3300039447 Bacteria 3399
95 Ga0436361_1125925 3300039447 Bacteria 1135
96 Ga0439432_017961 3300042006 Bacteria 2369
97 Ga0439452_000001 3300042010 Bacteria 1725439
98 Ga0451577_0001771 3300042876 Bacteria 27782
99 Ga0451577_0013085 3300042876 Bacteria 7780
100 Ga0451577_0099492 3300042876 Bacteria 2598
101 Ga0453684_0059580 3300044712 Bacteria 4920
102 Ga0451576_0000816 3300045051 Bacteria 60979
103 Ga0451576_0008359 3300045051 Bacteria 12158
104 Ga0451576_0241009 3300045051 Bacteria 1889
105 Ga0495642_0128061 3300046528 Bacteria 1092
106 Ga0495642_0145785 3300046528 Bacteria 1023
107 Ga0495687_028282 3300047443 Bacteria 2610
108 Ga0496109_0458234 3300048912 Bacteria 1204
109 Ga0496116_0000400 3300048919 Bacteria 62976
110 Ga0496117_0009046 3300048920 Bacteria 9365
111 Ga0496118_0001875 3300048921 Bacteria 30019
112 Ga0501031_0003353 3300049568 Bacteria 10285
113 Ga0501031_0005343 3300049568 Bacteria 8365
114 Ga0501031_0093480 3300049568 Bacteria 1962
115 Ga0501032_0012536 3300049569 Bacteria 6053
116 Ga0501033_0000289 3300049570 Bacteria 48277
117 Ga0501033_0022060 3300049570 Bacteria 4804
118 Ga0501034_0000047 3300049571 Bacteria 223793
119 Ga0501034_0003678 3300049571 Bacteria 17335
120 Ga0501034_0015394 3300049571 Bacteria 7860
121 Ga0501034_0111983 3300049571 Bacteria 2720
122 Ga0501034_0187313 3300049571 Bacteria 2032
123 Ga0501036_0000051 3300049572 Bacteria 75057
124 Ga0501036_0021197 3300049572 Bacteria 5459
125 Ga0501037_0014806 3300049573 Bacteria 5738
126 Ga0501037_0077007 3300049573 Bacteria 2420
127 Ga0501037_0156563 3300049573 Bacteria 1626
128 Ga0501037_0213726 3300049573 Bacteria 1359
129 Ga0501038_0008703 3300049574 Bacteria 9317
130 Ga0501043_0001811 3300049579 Bacteria 18388
131 Ga0501043_0007120 3300049579 Bacteria 8899
132 Ga0501043_0094715 3300049579 Bacteria 2347
133 Ga0501046_0000470 3300049580 Bacteria 40368
134 Ga0501046_0006257 3300049580 Bacteria 10560
135 Ga0501046_0233736 3300049580 Bacteria 1357
136 Ga0501047_0000034 3300049581 Bacteria 198118
137 Ga0501047_0013272 3300049581 Bacteria 7804
138 Ga0501047_0061385 3300049581 Bacteria 3627
139 Ga0501047_0137249 3300049581 Bacteria 2325
140 Ga0501068_0042817 3300049584 Bacteria 2722
141 Ga0501068_0065443 3300049584 Bacteria 2213
142 Ga0501070_0004594 3300049586 Bacteria 11835
143 Ga0501070_0005597 3300049586 Bacteria 10715
144 Ga0501072_0000010 3300049588 Bacteria 205637
145 Ga0501073_0029577 3300049589 Bacteria 3914
146 Ga0501073_0148826 3300049589 Bacteria 1622
147 Ga0501074_0000842 3300049590 Bacteria 19522
148 Ga0501074_0014625 3300049590 Bacteria 5709
149 Ga0501079_0001746 3300049741 Bacteria 15501
150 Ga0501080_0002566 3300049742 Bacteria 15911
151 Ga0501080_0010831 3300049742 Bacteria 8343
152 Ga0501083_0002826 3300049744 Bacteria 11994
153 Ga0501280_001934 3300049776 Bacteria 3613
154 Ga0501035_0001784 3300049822 Bacteria 21748
155 Ga0501035_0098988 3300049822 Bacteria 2560
156 Ga0501035_0345485 3300049822 Bacteria 1246
157 Ga0501044_0068208 3300049823 Bacteria 3623
158 Ga0501044_0079250 3300049823 Bacteria 3328
159 Ga0501084_0000163 3300054114 Bacteria 51142
160 Ga0501082_0015358 3300060353 Bacteria 6589
161 2521558263 2521172590 Bacteria 5047645
162 2553007507 2551306416 Bacteria 6152985
163 2566037953 2565956521 Bacteria 4468993
164 2599927683 2599185299 Bacteria 4854625
165 2644168723 2643221629 Bacteria 5850260
166 2644303125 2643221654 Bacteria 5273570
167 2650895710 2648501693 Bacteria 5069560
168 2686353026 2684622997 Bacteria 4624240
169 2723879128 2721755763 Bacteria 4464185
170 2809126880 2808606414 Bacteria 4917181
171 2819614582 2818991449 Bacteria 5518009
172 2846036860 2846033681 Bacteria 4377894
173 2847800232 2847797336 Bacteria 5176640
174 2887375904 2887375801 Bacteria 5334027
175 2904436299 2904434214 Bacteria 6230908
176 2904587659 2904584206 Bacteria 6028872
177 2904590181 2904589729 Bacteria 6113573
178 2904602437 2904601388 Bacteria 5884906
179 2919080063 2919079590 Bacteria 5946433
180 2923511870 2923510766 Bacteria 5926163
181 2928119780 2928115317 Bacteria 6477646
182 2928131463 2928130867 Bacteria 5467269
183 2984496258 2984494565 Bacteria 5000175
184 2990262935 2990261002 Bacteria 4919493
185 2990711025 2990710928 Bacteria 5002431
186 2998347430 2998344455 Bacteria 4222996
187 8034965011 8034962539 Bacteria 4884839
188 8039102815 8039098773 Bacteria 6602928
189 8054358587 8054357960 Bacteria 2867777
190 Ga0105240_10032662
191 JGI24739J22299_10018140
192 JGI25155J39150_1000100
193 JGI25156J39149_1000179
194 JGI25156J39149_1001406
195 JGI25154J39366_1000186
196 JGI25157J39369_1000220
197 Ga0055538_1000119
198 Ga0055539_1000164
199 Ga0055533_1000168
200 Ga0055525_1000228
201 Ga0055529_1001069
202 Ga0055541_1000111
203 Ga0068853_100074900
204 Ga0068855_100018394
205 Ga0068855_100106005
206 Ga0068855_100340015
207 Ga0068854_100024556
208 Ga0070717_10031086
209 Ga0105251_10002080
210 Ga0105244_10006824
211 Ga0105244_10035879
212 Ga0105240_10037014
213 Ga0105240_10064235
214 Ga0105240_10073738
215 Ga0105247_10000657
216 Ga0105242_10005718
217 Ga0105237_10451127
218 Ga0105238_10052650
219 Ga0105148_100593
220 Ga0105239_10442112
221 Ga0157373_10012538
222 Ga0157373_10014243
223 Ga0157371_10012908
224 Ga0157370_10000699
225 Ga0157369_10011839
226 Ga0182006_1000626
227 Ga0213872_10000055
228 Ga0213872_10002347
229 Ga0213872_10011608
230 Ga0213872_10167354
231 Ga0209435_100034
232 Ga0209784_100018
233 Ga0209566_100016
234 Ga0209674_100030
235 Ga0209672_101843
236 Ga0209563_100034
237 Ga0209258_100294
238 Ga0209646_1000118
239 Ga0209026_1000106
240 Ga0209677_100019
241 Ga0209759_1000455
242 Ga0209759_1001084
243 Ga0209455_1000589
244 Ga0209455_1017420
245 Ga0207655_1012711
246 Ga0207713_1029488
247 Ga0207710_10000642
248 Ga0207695_10000377
249 Ga0207695_10022920
250 Ga0207695_10027883
251 Ga0207695_10048529
252 Ga0207694_10041037
253 Ga0207694_10069991
254 Ga0207667_10000036
255 Ga0207667_10020282
256 Ga0207640_10005936
257 Ga0207639_10072408
258 Ga0265327_10000058
259 Ga0316575_10051159
260 Ga0316576_10102889
261 Ga0316576_10121705
262 Ga0316576_10176917
263 Ga0316576_10257954
264 Ga0316578_10059537
265 Ga0316580_10027646
266 Ga0316574_0033488
267 Ga0316574_0125479
268 Ga0316574_0128584
269 Ga0316582_0059922
270 Ga0316584_0286572
271 Ga0395899_0000506
272 Ga0395899_0228362
273 Ga0395900_0008850
274 Ga0395900_0127251
275 Ga0395900_0236078
276 Ga0395898_0307982
277 Ga0395901_0019811
278 Ga0395901_0412494
279 Ga0436361_0149060
280 Ga0436361_0149866
281 Ga0436361_0305518
282 Ga0436361_0749269
283 Ga0436361_1080012
284 Ga0436361_1125925
285 Ga0439432_017961
286 Ga0439452_000001
287 Ga0451577_0001771
288 Ga0451577_0013085
289 Ga0451577_0099492
290 Ga0453684_0059580
291 Ga0451576_0000816
292 Ga0451576_0008359
293 Ga0451576_0241009
294 Ga0495642_0128061
295 Ga0495642_0145785
296 Ga0495687_028282
297 Ga0496109_0458234
298 Ga0496116_0000400
299 Ga0496117_0009046
300 Ga0496118_0001875
301 Ga0501031_0003353
302 Ga0501031_0005343
303 Ga0501031_0093480
304 Ga0501032_0012536
305 Ga0501033_0000289
306 Ga0501033_0022060
307 Ga0501034_0000047
308 Ga0501034_0003678
309 Ga0501034_0015394
310 Ga0501034_0111983
311 Ga0501034_0187313
312 Ga0501036_0000051
313 Ga0501036_0021197
314 Ga0501037_0014806
315 Ga0501037_0077007
316 Ga0501037_0156563
317 Ga0501037_0213726
318 Ga0501038_0008703
319 Ga0501043_0001811
320 Ga0501043_0007120
321 Ga0501043_0094715
322 Ga0501046_0000470
323 Ga0501046_0006257
324 Ga0501046_0233736
325 Ga0501047_0000034
326 Ga0501047_0013272
327 Ga0501047_0061385
328 Ga0501047_0137249
329 Ga0501068_0042817
330 Ga0501068_0065443
331 Ga0501070_0004594
332 Ga0501070_0005597
333 Ga0501072_0000010
334 Ga0501073_0029577
335 Ga0501073_0148826
336 Ga0501074_0000842
337 Ga0501074_0014625
338 Ga0501079_0001746
339 Ga0501080_0002566
340 Ga0501080_0010831
341 Ga0501083_0002826
342 Ga0501280_001934
343 Ga0501035_0001784
344 Ga0501035_0098988
345 Ga0501035_0345485
346 Ga0501044_0068208
347 Ga0501044_0079250
348 Ga0501084_0000163
349 Ga0501082_0015358
350 2521558263
351 2553007507
352 2566037953
353 2599927683
354 2644168723
355 2644303125
356 2650895710
357 2686353026
358 2723879128
359 2809126880
360 2819614582
361 2846036860
362 2847800232
363 2887375904
364 2904436299
365 2904587659
366 2904590181
367 2904602437
368 2919080063
369 2923511870
370 2928119780
371 2928131463
372 2984496258
373 2990262935
374 2990711025
375 2998347430
376 8034965011
377 8039102815
378 8054358587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

15

74

0.98

PF03466

LysR_substrate

LysR substrate binding domain

97

299

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9216 35 117
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9125 30 119
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.9116 35 101
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.903 30 119
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.883 35 117
ID Description Score Start End Superfamily
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 36 117 1.10.10.10
af_P0A9G2_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9548 30 113 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 36 117 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9505 32 114 1.10.10.10
af_P75836_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 35 118 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R1NF86-F1-model_v4 deleted 0.9549 35 107
AF-T0ZQZ5-F1-model_v4 Transcriptional regulator, LysR family protein 0.9152 167 328 GO:0000976
GO:0006355
AF-A0A7Y8HXQ6-F1-model_v4 LysR family transcriptional regulator 0.895 35 113 GO:0000976
GO:0003700
AF-T0ZQZ5-F1-model_v4 Transcriptional regulator, LysR family protein 0.8941 167 328 GO:0000976
GO:0006355
AF-A0A4Q6BRT4-F1-model_v4 LysR family transcriptional regulator 0.8853 117 320 GO:0003677
GO:0003700
GO:2000142

Map