F290674

General Info

Members Datasets Scaffolds Average Seq Length
189 100 378 275

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100135655|Ga0068861_1001356552
Length 330
Sequence MSALETNPAAERSPELSQVHAALVAGERPPRPGIVAQCLTFGWRGMLKIKHVPEQLIDVTLTPVLFLLMFTYLFGGAVAGSTGDYLQFLLPGMLVQSVLFVSVYSGVALNTDMTKGVVDRFRSLPIWRPAPLVGAVVGDSVRYVLASAIVVVLGLIMGFDAEGGVPGVLAAVAIVCVFSFGLSWAFTTLGLVMRAPNAVMNTGFMLLFPLIFLSNIFVDPSTLPGWLEAFVDVNPISHLVTSARGLMAGDVDTESLAVSLLSAGVLTAVFAPLTVRLYRKAPRGHTERARSEEGGMTVAVVPWLELVITVGGVLAVFFGFTLGLLWIWNR

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
54 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
55 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
95 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
96 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
97 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
98 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
99 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
100 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0.53
Rhizoplane 0.53
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100135655 3300005719 Bacteria 2002
2 JGI25407J50210_10002563 3300003373 Bacteria 4295
3 JGI25407J50210_10049860 3300003373 Bacteria 1062
4 JGI25405J52794_10024164 3300003911 Bacteria 1240
5 Ga0070683_100038638 3300005329 Bacteria 4376
6 Ga0070683_100063841 3300005329 Bacteria 3426
7 Ga0070668_100098925 3300005347 Bacteria 2309
8 Ga0070700_100027878 3300005441 Bacteria 3354
9 Ga0068867_100107561 3300005459 Bacteria 2138
10 Ga0068857_100327671 3300005577 Bacteria 1415
11 Ga0068854_100251965 3300005578 Bacteria 1410
12 Ga0081455_10000667 3300005937 Bacteria 44477
13 Ga0081455_10026335 3300005937 Bacteria 5351
14 Ga0081455_10037102 3300005937 Bacteria 4332
15 Ga0081455_10115212 3300005937 Bacteria 2128
16 Ga0081538_10000064 3300005981 Bacteria 99059
17 Ga0081538_10001787 3300005981 Bacteria 21697
18 Ga0081538_10003051 3300005981 Bacteria 15958
19 Ga0081538_10003431 3300005981 Bacteria 14991
20 Ga0081538_10003433 3300005981 Bacteria 14974
21 Ga0081538_10012008 3300005981 Bacteria 6977
22 Ga0081538_10016191 3300005981 Bacteria 5731
23 Ga0081538_10017022 3300005981 Bacteria 5540
24 Ga0081538_10025506 3300005981 Bacteria 4164
25 Ga0081538_10043623 3300005981 Bacteria 2812
26 Ga0081538_10045039 3300005981 Bacteria 2740
27 Ga0081538_10056024 3300005981 Bacteria 2314
28 Ga0081538_10078673 3300005981 Bacteria 1768
29 Ga0081538_10085838 3300005981 Bacteria 1651
30 Ga0081538_10087265 3300005981 Bacteria 1629
31 Ga0081540_1036730 3300005983 Bacteria 2608
32 Ga0075365_10001113 3300006038 Bacteria 11728
33 Ga0075428_100050431 3300006844 Bacteria 4565
34 Ga0075428_100166447 3300006844 Bacteria 2391
35 Ga0075430_100024699 3300006846 Bacteria 5111
36 Ga0075430_100087694 3300006846 Bacteria 2604
37 Ga0075431_100041847 3300006847 Bacteria 4725
38 Ga0075431_100275701 3300006847 Bacteria 1703
39 Ga0075431_100750194 3300006847 Bacteria 951
40 Ga0075429_100086080 3300006880 Bacteria 2739
41 Ga0075429_100351453 3300006880 Bacteria 1290
42 Ga0075429_100582070 3300006880 Bacteria 981
43 Ga0111539_10008512 3300009094 Bacteria 13034
44 Ga0111539_10153225 3300009094 Bacteria 2698
45 Ga0114129_10026839 3300009147 Bacteria 8153
46 Ga0114129_10159004 3300009147 Bacteria 3088
47 Ga0105243_10260330 3300009148 Bacteria 1553
48 Ga0105249_10234817 3300009553 Bacteria 1810
49 Ga0105148_103257 3300009978 Bacteria 1151
50 Ga0157369_10629617 3300013105 Bacteria 1107
51 Ga0207688_10056931 3300025901 Bacteria 2197
52 Ga0207643_10021721 3300025908 Bacteria 3530
53 Ga0207704_10161974 3300025938 Bacteria 1593
54 Ga0207691_10244837 3300025940 Bacteria 1549
55 Ga0207661_10030269 3300025944 Bacteria 4168
56 Ga0207661_10256075 3300025944 Bacteria 1557
57 Ga0207661_10292614 3300025944 Bacteria 1458
58 Ga0207668_10398639 3300025972 Bacteria 1163
59 Ga0207668_10692405 3300025972 Bacteria 895
60 Ga0207640_10155205 3300025981 Bacteria 1687
61 Ga0207708_10052614 3300026075 Bacteria 3101
62 Ga0207648_10201025 3300026089 Bacteria 1767
63 Ga0207674_10303313 3300026116 Bacteria 1546
64 Ga0207675_100320826 3300026118 Bacteria 1512
65 Ga0207698_10426026 3300026142 Bacteria 1275
66 Ga0207428_10096308 3300027907 Bacteria 2292
67 Ga0207428_10443541 3300027907 Bacteria 947
68 Ga0268265_10445033 3300028380 Bacteria 1209
69 Ga0307405_10033136 3300031731 Bacteria 3061
70 Ga0307410_10144772 3300031852 Bacteria 1762
71 Ga0307406_10075979 3300031901 Bacteria 2218
72 Ga0307406_10092388 3300031901 Bacteria 2040
73 Ga0307406_10244971 3300031901 Bacteria 1347
74 Ga0307406_10381713 3300031901 Bacteria 1111
75 Ga0307407_10132910 3300031903 Bacteria 1595
76 Ga0307407_10138536 3300031903 Bacteria 1567
77 Ga0307407_10263259 3300031903 Bacteria 1187
78 Ga0307412_10067931 3300031911 Bacteria 2422
79 Ga0307412_10117980 3300031911 Bacteria 1906
80 Ga0307412_10436695 3300031911 Bacteria 1075
81 Ga0307409_100060316 3300031995 Bacteria 2958
82 Ga0307409_100061001 3300031995 Bacteria 2944
83 Ga0307409_100105917 3300031995 Bacteria 2345
84 Ga0307409_100239588 3300031995 Bacteria 1650
85 Ga0307409_100326898 3300031995 Bacteria 1437
86 Ga0307409_100643303 3300031995 Bacteria 1053
87 Ga0307416_100035055 3300032002 Bacteria 3827
88 Ga0307416_100123048 3300032002 Bacteria 2317
89 Ga0307416_100221539 3300032002 Bacteria 1815
90 Ga0307416_100270810 3300032002 Bacteria 1667
91 Ga0307416_100836866 3300032002 Bacteria 1018
92 Ga0307414_10061576 3300032004 Bacteria 2659
93 Ga0307414_10373156 3300032004 Bacteria 1231
94 Ga0307411_10024721 3300032005 Bacteria 3586
95 Ga0307411_10226647 3300032005 Bacteria 1454
96 Ga0307411_10262855 3300032005 Bacteria 1364
97 Ga0307411_10574729 3300032005 Bacteria 965
98 Ga0307415_100094351 3300032126 Bacteria 2175
99 Ga0307415_100349468 3300032126 Bacteria 1244
100 Ga0307415_100422076 3300032126 Bacteria 1145
101 Ga0395899_0045666 3300037312 Bacteria 3264
102 Ga0395900_0026259 3300037418 Bacteria 5964
103 Ga0395900_0187661 3300037418 Bacteria 2098
104 Ga0395898_0060755 3300037466 Bacteria 3672
105 Ga0395905_0077245 3300037471 Bacteria 3120
106 Ga0395901_0010771 3300038443 Bacteria 9270
107 Ga0395901_0201084 3300038443 Bacteria 2088
108 Ga0439450_004047 3300042008 Bacteria 2475
109 Ga0439463_023429 3300042016 Bacteria 1546
110 Ga0439464_0017505 3300042439 Bacteria 1944
111 Ga0466959_0325995 3300045049 Bacteria 1049
112 Ga0495672_0058168 3300047320 Bacteria 2242
113 Ga0496110_0775388 3300048913 Bacteria 863
114 Ga0496126_0117712 3300048929 Bacteria 2308
115 Ga0501031_0008871 3300049568 Bacteria 6536
116 Ga0501032_0049532 3300049569 Bacteria 2834
117 Ga0501033_0118975 3300049570 Bacteria 1918
118 Ga0501034_0919666 3300049571 Bacteria 762
119 Ga0501036_0003334 3300049572 Bacteria 12828
120 Ga0501036_0170273 3300049572 Bacteria 1835
121 Ga0501037_0011145 3300049573 Bacteria 6616
122 Ga0501038_0001336 3300049574 Bacteria 22427
123 Ga0501039_0012339 3300049575 Bacteria 6519
124 Ga0501039_0120070 3300049575 Bacteria 2060
125 Ga0501039_0304205 3300049575 Bacteria 1254
126 Ga0501040_0009775 3300049576 Bacteria 6262
127 Ga0501040_0115107 3300049576 Bacteria 1883
128 Ga0501040_0270617 3300049576 Bacteria 1213
129 Ga0501041_0008102 3300049577 Bacteria 6185
130 Ga0501041_0037697 3300049577 Bacteria 2930
131 Ga0501041_0184536 3300049577 Bacteria 1306
132 Ga0501042_0010904 3300049578 Bacteria 6117
133 Ga0501042_0107943 3300049578 Bacteria 2004
134 Ga0501046_0003239 3300049580 Bacteria 14962
135 Ga0501046_0507249 3300049580 Bacteria 863
136 Ga0501047_0241897 3300049581 Bacteria 1655
137 Ga0501068_0048985 3300049584 Bacteria 2551
138 Ga0501068_0283489 3300049584 Bacteria 1059
139 Ga0501071_0004396 3300049587 Bacteria 8943
140 Ga0501071_0019251 3300049587 Bacteria 4736
141 Ga0501072_0000337 3300049588 Bacteria 33414
142 Ga0501072_0265270 3300049588 Bacteria 1367
143 Ga0501073_0113051 3300049589 Bacteria 1883
144 Ga0501074_0006576 3300049590 Bacteria 8405
145 Ga0501074_0390502 3300049590 Bacteria 987
146 Ga0501075_0001380 3300049591 Bacteria 15809
147 Ga0501075_0107671 3300049591 Bacteria 2119
148 Ga0501076_0022269 3300049592 Bacteria 4868
149 Ga0501076_0111662 3300049592 Bacteria 2210
150 Ga0501076_0215422 3300049592 Bacteria 1570
151 Ga0501077_0002078 3300049593 Bacteria 12071
152 Ga0501077_0133071 3300049593 Bacteria 1577
153 Ga0501077_0232756 3300049593 Bacteria 1171
154 Ga0501079_0032932 3300049741 Bacteria 3985
155 Ga0501079_0282485 3300049741 Bacteria 1298
156 Ga0501080_0006995 3300049742 Bacteria 10185
157 Ga0501080_0224979 3300049742 Bacteria 1716
158 Ga0501080_0380078 3300049742 Bacteria 1273
159 Ga0501081_0013795 3300049743 Bacteria 5317
160 Ga0501081_0375401 3300049743 Bacteria 1050
161 Ga0501035_0004749 3300049822 Bacteria 12898
162 Ga0501045_0009446 3300049824 Bacteria 6823
163 Ga0501045_0231000 3300049824 Bacteria 1377
164 Ga0501045_0368846 3300049824 Bacteria 1069
165 nmdc:mga05p37_718411_c1 3300050507 Bacteria 1107
166 nmdc:mga05p37_72573_c1 3300050507 Bacteria 4236
167 nmdc:mga09592_32718_c1 3300050508 Bacteria 4336
168 nmdc:mga09592_361234_c1 3300050508 Bacteria 1256
169 nmdc:mga0qj67_44946_c1 3300050509 Bacteria 3484
170 nmdc:mga0qj67_592937_c1 3300050509 Bacteria 887
171 nmdc:mga06r32_145591_c1 3300050510 Bacteria 2347
172 nmdc:mga06r32_48439_c1 3300050510 Bacteria 4062
173 nmdc:mga08y16_181670_c1 3300050511 Bacteria 2184
174 nmdc:mga08y16_48451_c1 3300050511 Bacteria 4447
175 Ga0500643_000384 3300053087 Bacteria 34456
176 Ga0501084_0002381 3300054114 Bacteria 15126
177 Ga0501082_0017800 3300060353 Bacteria 6121
178 Ga0501082_0403214 3300060353 Bacteria 1193
179 Ga0501082_0567301 3300060353 Bacteria 993
180 Ga0530510_0007055 3300061734 Bacteria 7821
181 Ga0530510_0059657 3300061734 Bacteria 2760
182 Ga0530510_0120923 3300061734 Bacteria 1922
183 Ga0530510_0423189 3300061734 Bacteria 1005
184 2554257919 2554235005 Bacteria 6457341
185 2712199436 2711768088 Bacteria 3195027
186 2734976301 2734482000 Bacteria 5525167
187 2739327882 2738543027 Bacteria 6409078
188 2868089876 2868088558 Bacteria 7609351
189 8054708074 8054704163 Bacteria 7247792
190 Ga0068861_100135655
191 JGI25407J50210_10002563
192 JGI25407J50210_10049860
193 JGI25405J52794_10024164
194 Ga0070683_100038638
195 Ga0070683_100063841
196 Ga0070668_100098925
197 Ga0070700_100027878
198 Ga0068867_100107561
199 Ga0068857_100327671
200 Ga0068854_100251965
201 Ga0081455_10000667
202 Ga0081455_10026335
203 Ga0081455_10037102
204 Ga0081455_10115212
205 Ga0081538_10000064
206 Ga0081538_10001787
207 Ga0081538_10003051
208 Ga0081538_10003431
209 Ga0081538_10003433
210 Ga0081538_10012008
211 Ga0081538_10016191
212 Ga0081538_10017022
213 Ga0081538_10025506
214 Ga0081538_10043623
215 Ga0081538_10045039
216 Ga0081538_10056024
217 Ga0081538_10078673
218 Ga0081538_10085838
219 Ga0081538_10087265
220 Ga0081540_1036730
221 Ga0075365_10001113
222 Ga0075428_100050431
223 Ga0075428_100166447
224 Ga0075430_100024699
225 Ga0075430_100087694
226 Ga0075431_100041847
227 Ga0075431_100275701
228 Ga0075431_100750194
229 Ga0075429_100086080
230 Ga0075429_100351453
231 Ga0075429_100582070
232 Ga0111539_10008512
233 Ga0111539_10153225
234 Ga0114129_10026839
235 Ga0114129_10159004
236 Ga0105243_10260330
237 Ga0105249_10234817
238 Ga0105148_103257
239 Ga0157369_10629617
240 Ga0207688_10056931
241 Ga0207643_10021721
242 Ga0207704_10161974
243 Ga0207691_10244837
244 Ga0207661_10030269
245 Ga0207661_10256075
246 Ga0207661_10292614
247 Ga0207668_10398639
248 Ga0207668_10692405
249 Ga0207640_10155205
250 Ga0207708_10052614
251 Ga0207648_10201025
252 Ga0207674_10303313
253 Ga0207675_100320826
254 Ga0207698_10426026
255 Ga0207428_10096308
256 Ga0207428_10443541
257 Ga0268265_10445033
258 Ga0307405_10033136
259 Ga0307410_10144772
260 Ga0307406_10075979
261 Ga0307406_10092388
262 Ga0307406_10244971
263 Ga0307406_10381713
264 Ga0307407_10132910
265 Ga0307407_10138536
266 Ga0307407_10263259
267 Ga0307412_10067931
268 Ga0307412_10117980
269 Ga0307412_10436695
270 Ga0307409_100060316
271 Ga0307409_100061001
272 Ga0307409_100105917
273 Ga0307409_100239588
274 Ga0307409_100326898
275 Ga0307409_100643303
276 Ga0307416_100035055
277 Ga0307416_100123048
278 Ga0307416_100221539
279 Ga0307416_100270810
280 Ga0307416_100836866
281 Ga0307414_10061576
282 Ga0307414_10373156
283 Ga0307411_10024721
284 Ga0307411_10226647
285 Ga0307411_10262855
286 Ga0307411_10574729
287 Ga0307415_100094351
288 Ga0307415_100349468
289 Ga0307415_100422076
290 Ga0395899_0045666
291 Ga0395900_0026259
292 Ga0395900_0187661
293 Ga0395898_0060755
294 Ga0395905_0077245
295 Ga0395901_0010771
296 Ga0395901_0201084
297 Ga0439450_004047
298 Ga0439463_023429
299 Ga0439464_0017505
300 Ga0466959_0325995
301 Ga0495672_0058168
302 Ga0496110_0775388
303 Ga0496126_0117712
304 Ga0501031_0008871
305 Ga0501032_0049532
306 Ga0501033_0118975
307 Ga0501034_0919666
308 Ga0501036_0003334
309 Ga0501036_0170273
310 Ga0501037_0011145
311 Ga0501038_0001336
312 Ga0501039_0012339
313 Ga0501039_0120070
314 Ga0501039_0304205
315 Ga0501040_0009775
316 Ga0501040_0115107
317 Ga0501040_0270617
318 Ga0501041_0008102
319 Ga0501041_0037697
320 Ga0501041_0184536
321 Ga0501042_0010904
322 Ga0501042_0107943
323 Ga0501046_0003239
324 Ga0501046_0507249
325 Ga0501047_0241897
326 Ga0501068_0048985
327 Ga0501068_0283489
328 Ga0501071_0004396
329 Ga0501071_0019251
330 Ga0501072_0000337
331 Ga0501072_0265270
332 Ga0501073_0113051
333 Ga0501074_0006576
334 Ga0501074_0390502
335 Ga0501075_0001380
336 Ga0501075_0107671
337 Ga0501076_0022269
338 Ga0501076_0111662
339 Ga0501076_0215422
340 Ga0501077_0002078
341 Ga0501077_0133071
342 Ga0501077_0232756
343 Ga0501079_0032932
344 Ga0501079_0282485
345 Ga0501080_0006995
346 Ga0501080_0224979
347 Ga0501080_0380078
348 Ga0501081_0013795
349 Ga0501081_0375401
350 Ga0501035_0004749
351 Ga0501045_0009446
352 Ga0501045_0231000
353 Ga0501045_0368846
354 nmdc:mga05p37_718411_c1
355 nmdc:mga05p37_72573_c1
356 nmdc:mga09592_32718_c1
357 nmdc:mga09592_361234_c1
358 nmdc:mga0qj67_44946_c1
359 nmdc:mga0qj67_592937_c1
360 nmdc:mga06r32_145591_c1
361 nmdc:mga06r32_48439_c1
362 nmdc:mga08y16_181670_c1
363 nmdc:mga08y16_48451_c1
364 Ga0500643_000384
365 Ga0501084_0002381
366 Ga0501082_0017800
367 Ga0501082_0403214
368 Ga0501082_0567301
369 Ga0530510_0007055
370 Ga0530510_0059657
371 Ga0530510_0120923
372 Ga0530510_0423189
373 2554257919
374 2712199436
375 2734976301
376 2739327882
377 2868089876
378 8054708074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

36

248

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.7181 74 276
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.7057 32 282
8f5b-assembly1.cif.gz_A human abca4 structure in complex with amp-pnp 0.7054 91 279
7w02-assembly1.cif.gz_A cryo-em structure of atp-bound abca3 0.6999 91 273
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6964 38 279
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8344 85 277 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.828 87 275 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7905 87 279 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5914 85 277 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5753 87 275 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A127SX38-F1-model_v4 ABC2_membrane 0.9771 85 280 GO:0016020
GO:0140359
AF-S9SC56-F1-model_v4 Transport permease protein 0.975 28 282 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0140359
GO:1900753
AF-A0A520E013-F1-model_v4 Transport permease protein 0.9734 53 282 GO:0043190
GO:0140359
AF-A0A7X7CWJ3-F1-model_v4 Transport permease protein 0.9726 26 279 GO:0043190
GO:0140359
AF-A0A1H8MAP4-F1-model_v4 Transport permease protein 0.971 47 279 GO:0043190
GO:0140359

Map