F290645

General Info

Members Datasets Scaffolds Average Seq Length
189 122 190 110

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100195434|Ga0068854_1001954341
Length 117
Sequence MSEKAMTHKEFEEYLLSFPNTWLGFPFGEGTSVYKIGHKETGEGKIFAIIQDGSKPLRVSLKCDPHLAETLREKYETVVPGYHLNKKHWNTILVTGQLTNDELQDLARHSYQLVSGS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
68 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
82 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
98 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
112 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
113 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
116 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
117 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
120 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
121 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
122 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.04
Nodule 0
Rhizoplane 1.06
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12120710 2162886012 Unclassified 2319
2 MBSR1b_contig_1226760 2162886012 Unclassified 2583
3 rootH1_10003685 3300003316 Bacteria 49635
4 rootH1_10003685 3300003323 Bacteria 21096
5 rootH2_10008921 3300003320 Bacteria 50114
6 rootH2_10242516 3300003320 Bacteria 2470
7 rootL2_10380321 3300003322 Unclassified 1325
8 rootH1_10001727 3300003323 Bacteria 102468
9 rootH1_10379776 3300003323 Bacteria 1367
10 JGI25405J52794_10005825 3300003911 Bacteria 2236
11 Ga0065715_10090517 3300005293 Bacteria 6877
12 Ga0070683_100009101 3300005329 Bacteria 8477
13 Ga0070690_100008622 3300005330 Bacteria 5880
14 Ga0068868_100549775 3300005338 Bacteria 1017
15 Ga0070660_100312165 3300005339 Bacteria 1290
16 Ga0070659_101689508 3300005366 Unclassified 566
17 Ga0070681_10117573 3300005458 Bacteria 2595
18 Ga0070679_100450353 3300005530 Bacteria 1232
19 Ga0070684_100003232 3300005535 Bacteria 12185
20 Ga0068853_100293086 3300005539 Bacteria 1502
21 Ga0070686_100031726 3300005544 Bacteria 3233
22 Ga0068855_100000002 3300005563 Bacteria 616881
23 Ga0068855_100014163 3300005563 Bacteria 9608
24 Ga0068855_100614889 3300005563 Bacteria 1170
25 Ga0068857_100086990 3300005577 Bacteria 2795
26 Ga0068854_100195434 3300005578 Bacteria 1587
27 Ga0068856_100095746 3300005614 Unclassified 2957
28 Ga0068856_100170683 3300005614 Bacteria 2187
29 Ga0081455_10000006 3300005937 Bacteria 323066
30 Ga0075365_10000005 3300006038 Bacteria 125137
31 Ga0075365_10000113 3300006038 Bacteria 23945
32 Ga0075365_10001282 3300006038 Bacteria 11175
33 Ga0075365_10005326 3300006038 Bacteria 6925
34 Ga0075368_10000664 3300006042 Bacteria 10443
35 Ga0075363_100241895 3300006048 Bacteria 1037
36 Ga0075364_10000166 3300006051 Bacteria 29442
37 Ga0075364_10222874 3300006051 Bacteria 1280
38 Ga0075362_10125130 3300006177 Bacteria 1219
39 Ga0075367_10010207 3300006178 Unclassified 4925
40 Ga0075369_10000004 3300006186 Bacteria 154675
41 Ga0075369_10003077 3300006186 Bacteria 6042
42 Ga0075370_10006167 3300006353 Bacteria 6014
43 Ga0105240_10000030 3300009093 Bacteria 321312
44 Ga0105240_10406334 3300009093 Bacteria 1533
45 Ga0105240_10813940 3300009093 Bacteria 1011
46 Ga0105245_10038613 3300009098 Unclassified 4248
47 Ga0105245_10212389 3300009098 Bacteria 1863
48 Ga0105241_10019510 3300009174 Bacteria 5000
49 Ga0105241_10486826 3300009174 Bacteria 1097
50 Ga0105237_10000001 3300009545 Bacteria 1009213
51 Ga0105237_12686066 3300009545 Bacteria 509
52 Ga0105032_100002 3300009979 Bacteria 303884
53 Ga0105032_100010 3300009979 Bacteria 81059
54 Ga0105239_10361034 3300010375 Bacteria 1641
55 Ga0157314_1005911 3300012500 Bacteria 943
56 Ga0157371_10003785 3300013102 Bacteria 13544
57 Ga0157371_10088640 3300013102 Bacteria 2191
58 Ga0157371_10361265 3300013102 Bacteria 1058
59 Ga0157370_10000232 3300013104 Bacteria 71177
60 Ga0157370_10072532 3300013104 Bacteria 3248
61 Ga0157369_10000003 3300013105 Bacteria 507337
62 Ga0157369_10016734 3300013105 Bacteria 8242
63 Ga0157369_10043685 3300013105 Bacteria 4884
64 Ga0157369_11561551 3300013105 Bacteria 671
65 Ga0157374_10004004 3300013296 Bacteria 12384
66 Ga0157374_10160676 3300013296 Bacteria 2188
67 Ga0157374_11004517 3300013296 Unclassified 853
68 Ga0157378_10557995 3300013297 Bacteria 1151
69 Ga0157372_10000007 3300013307 Bacteria 340690
70 Ga0157372_10017752 3300013307 Bacteria 7638
71 Ga0157372_10106749 3300013307 Bacteria 3203
72 Ga0157372_13363210 3300013307 Unclassified 509
73 Ga0207654_10140609 3300025911 Bacteria 1539
74 Ga0207654_10324491 3300025911 Bacteria 1053
75 Ga0207707_10127029 3300025912 Bacteria 2230
76 Ga0207695_10000009 3300025913 Bacteria 1034276
77 Ga0207695_10571425 3300025913 Bacteria 1012
78 Ga0207671_10000003 3300025914 Bacteria 1065461
79 Ga0207657_10035664 3300025919 Unclassified 4459
80 Ga0207652_10404395 3300025921 Bacteria 1232
81 Ga0207690_11248452 3300025932 Unclassified 621
82 Ga0207661_10000526 3300025944 Bacteria 24641
83 Ga0207667_10000005 3300025949 Bacteria 715503
84 Ga0207667_10000278 3300025949 Bacteria 70630
85 Ga0207667_10997351 3300025949 Bacteria 825
86 Ga0207640_10174112 3300025981 Bacteria 1607
87 Ga0207677_11061565 3300026023 Unclassified 737
88 Ga0207702_10119014 3300026078 Unclassified 2361
89 Ga0207674_10105441 3300026116 Bacteria 2797
90 Ga0207674_10401683 3300026116 Bacteria 1324
91 Ga0209813_10000186 3300027866 Bacteria 19692
92 Ga0265337_1000048 3300028556 Bacteria 53749
93 Ga0265337_1013474 3300028556 Bacteria 2742
94 Ga0265326_10000208 3300028558 Bacteria 29214
95 Ga0265326_10003117 3300028558 Bacteria 5487
96 Ga0265334_10001327 3300028573 Bacteria 11930
97 Ga0265322_10001239 3300028654 Bacteria 8683
98 Ga0265322_10001580 3300028654 Bacteria 7308
99 Ga0265336_10000020 3300028666 Bacteria 213480
100 Ga0265338_10000093 3300028800 Bacteria 168444
101 Ga0265338_10001060 3300028800 Bacteria 45733
102 Ga0265338_10457892 3300028800 Bacteria 902
103 Ga0265324_10002301 3300029957 Bacteria 9933
104 Ga0316177_1189579 3300030731 Unclassified 573
105 Ga0314311_1150615 3300030733 Bacteria 8817
106 Ga0314311_1244209 3300030733 Bacteria 730
107 Ga0316179_1056598 3300030734 Bacteria 39107
108 Ga0316180_1029413 3300030736 Unclassified 4648
109 Ga0316183_1008390 3300030742 Bacteria 9967
110 Ga0316183_1024804 3300030742 Bacteria 1580
111 Ga0316183_1114883 3300030742 Bacteria 48072
112 Ga0316183_1183010 3300030742 Bacteria 4424
113 Ga0316181_1069799 3300030744 Bacteria 1679
114 Ga0316181_1123581 3300030744 Bacteria 76132
115 Ga0316181_1259951 3300030744 Bacteria 1154
116 Ga0316182_1010237 3300030745 Bacteria 8976
117 Ga0316182_1018373 3300030745 Bacteria 7132
118 Ga0316182_1080972 3300030745 Bacteria 682
119 Ga0316182_1234581 3300030745 Bacteria 23872
120 Ga0316182_1448605 3300030745 Bacteria 6335
121 Ga0265339_10071955 3300031249 Bacteria 1841
122 Ga0265339_10114825 3300031249 Bacteria 1389
123 Ga0265331_10033342 3300031250 Bacteria 2547
124 Ga0265316_10121986 3300031344 Unclassified 1968
125 Ga0307509_10032800 3300031507 Bacteria 5722
126 Ga0307405_10083314 3300031731 Bacteria 2096
127 Ga0307412_10002279 3300031911 Bacteria 10620
128 Ga0439461_0032022 3300041410 Unclassified 1100
129 Ga0439461_0210544 3300041410 Unclassified 526
130 Ga0451807_1533692 3300041486 Unclassified 804
131 Ga0451853_2166348 3300041512 Bacteria 576
132 Ga0439463_029630 3300042016 Unclassified 1379
133 Ga0450920_001428 3300042122 Bacteria 3951
134 Ga0450906_004889 3300042145 Bacteria 2787
135 Ga0450910_006352 3300042147 Bacteria 1630
136 Ga0439446_0000002 3300042156 Bacteria 177065
137 Ga0450909_007326 3300042185 Bacteria 1595
138 Ga0450909_062628 3300042185 Bacteria 589
139 Ga0439434_0017078 3300042435 Bacteria 2170
140 Ga0450918_000494 3300042531 Bacteria 8451
141 Ga0450918_035738 3300042531 Unclassified 884
142 Ga0466972_0045336 3300044658 Bacteria 2131
143 Ga0466965_0000207 3300044683 Bacteria 18400
144 Ga0466968_0552719 3300044735 Unclassified 578
145 Ga0466970_0165600 3300044765 Bacteria 1224
146 Ga0495660_0000114 3300046810 Bacteria 86218
147 Ga0495660_0331437 3300046810 Bacteria 681
148 Ga0495680_0571403 3300047322 Bacteria 759
149 Ga0496100_0011723 3300048903 Bacteria 4998
150 Ga0501073_0815171 3300049589 Bacteria 643
151 Ga0501223_049773 3300049663 Bacteria 813
152 nmdc:mga03683_7097_c1 3300050489 Bacteria 1114
153 nmdc:mga03n38_6386_c2 3300050490 Bacteria 1971
154 nmdc:mga00v17_128_c1 3300050491 Bacteria 44347
155 nmdc:mga0yw44_1016554_c1 3300050492 Bacteria 561
156 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
157 nmdc:mga0yw44_1238_c1 3300050492 Bacteria 10033
158 nmdc:mga0yw44_5963_c1 3300050492 Bacteria 5830
159 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
160 nmdc:mga06z11_13768_c1 3300050494 Unclassified 3563
161 nmdc:mga06z11_151_c1 3300050494 Bacteria 27161
162 nmdc:mga04h51_213_c1 3300050495 Bacteria 15573
163 nmdc:mga07m45_14804_c1 3300050496 Bacteria 4165
164 nmdc:mga07m45_271209_c1 3300050496 Bacteria 987
165 nmdc:mga0sz30_1649_c1 3300050516 Bacteria 6042
166 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
167 Ga0500643_005181 3300053087 Bacteria 5680
168 Ga0500644_0005371 3300053088 Bacteria 3234
169 Ga0500583_0004275 3300053092 Bacteria 4633
170 Ga0500583_0016445 3300053092 Bacteria 2953
171 Ga0500651_0000021 3300053093 Bacteria 137927
172 Ga0500651_0000105 3300053093 Bacteria 51140
173 Ga0500650_0166220 3300053098 Bacteria 1016
174 Ga0500554_137521 3300053102 Unclassified 826
175 Ga0500555_000001 3300053103 Bacteria 1353713
176 Ga0500555_000045 3300053103 Bacteria 63148
177 Ga0500556_0252964 3300053104 Bacteria 693
178 Ga0500593_000001 3300053117 Bacteria 784404
179 Ga0500594_0000106 3300053118 Bacteria 24380
180 Ga0500655_000068 3300053133 Bacteria 28266
181 Ga0500577_0000194 3300053142 Bacteria 16086
182 Ga0500577_0080721 3300053142 Bacteria 1296
183 Ga0500616_0000012 3300053153 Bacteria 681798
184 Ga0500616_0029620 3300053153 Bacteria 3011
185 Ga0500570_000807 3300053724 Bacteria 13185
186 Ga0500570_065853 3300053724 Bacteria 1723
187 Ga0500570_139073 3300053724 Bacteria 898
188 Ga0500611_104695 3300053727 Bacteria 737
189 Ga0500656_026212 3300053732 Unclassified 752
190 Ga0500613_006730 3300053738 Bacteria 1171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1013474 Ga0265337_10134742 92
2 3300028558 Ga0265326_10000208 Ga0265326_1000020822 92
3 3300028573 Ga0265334_10001327 Ga0265334_1000132710 92
4 3300028654 Ga0265322_10001580 Ga0265322_100015802 92
5 3300028666 Ga0265336_10000020 Ga0265336_10000020232 92
6 3300028800 Ga0265338_10000093 Ga0265338_1000009324 92
7 3300029957 Ga0265324_10002301 Ga0265324_100023015 92
8 3300031249 Ga0265339_10071955 Ga0265339_100719552 92
9 3300031250 Ga0265331_10033342 Ga0265331_100333422 92
10 3300031344 Ga0265316_10121986 Ga0265316_101219862 92
11 3300025932 Ga0207690_11248452 Ga0207690_112484521 94
12 3300005330 Ga0070690_100008622 Ga0070690_1000086222 96
13 3300005544 Ga0070686_100031726 Ga0070686_1000317265 96
14 3300009098 Ga0105245_10038613 Ga0105245_100386133 104
15 3300013105 Ga0157369_10043685 Ga0157369_100436852 104
16 3300013296 Ga0157374_10004004 Ga0157374_1000400411 104
17 3300003322 rootL2_10380321 rootL2_103803211 105
18 3300013105 Ga0157369_10016734 Ga0157369_100167342 105
19 3300028556 Ga0265337_1000048 Ga0265337_100004826 105
20 3300028800 Ga0265338_10001060 Ga0265338_1000106020 105
21 3300031507 Ga0307509_10032800 Ga0307509_100328005 105
22 3300041486 Ga0451807_1533692 Ga0451807_1533692_232_552 105
23 3300053093 Ga0500651_0000105 Ga0500651_0000105_5430_5759 105
24 3300053102 Ga0500554_137521 Ga0500554_137521_230_559 105
25 3300053142 Ga0500577_0000194 Ga0500577_0000194_2848_3177 105
26 3300053732 Ga0500656_026212 Ga0500656_026212_368_703 105
27 3300003320 rootH2_10242516 rootH2_102425163 106
28 3300005366 Ga0070659_101689508 Ga0070659_1016895082 106
29 3300005458 Ga0070681_10117573 Ga0070681_101175735 106
30 3300005530 Ga0070679_100450353 Ga0070679_1004503533 106
31 3300005539 Ga0068853_100293086 Ga0068853_1002930862 106
32 3300005563 Ga0068855_100014163 Ga0068855_1000141632 106
33 3300005563 Ga0068855_100614889 Ga0068855_1006148892 106
34 3300005614 Ga0068856_100170683 Ga0068856_1001706832 106
35 3300006178 Ga0075367_10010207 Ga0075367_100102075 106
36 3300006186 Ga0075369_10000004 Ga0075369_1000000453 106
37 3300009093 Ga0105240_10406334 Ga0105240_104063342 106
38 3300009098 Ga0105245_10212389 Ga0105245_102123892 106
39 3300009174 Ga0105241_10019510 Ga0105241_100195105 106
40 3300009174 Ga0105241_10486826 Ga0105241_104868262 106
41 3300010375 Ga0105239_10361034 Ga0105239_103610342 106
42 3300013102 Ga0157371_10003785 Ga0157371_100037857 106
43 3300013104 Ga0157370_10072532 Ga0157370_100725322 106
44 3300013296 Ga0157374_11004517 Ga0157374_110045172 106
45 3300013297 Ga0157378_10557995 Ga0157378_105579952 106
46 3300013307 Ga0157372_10017752 Ga0157372_100177527 106
47 3300013307 Ga0157372_10106749 Ga0157372_101067494 106
48 3300013307 Ga0157372_13363210 Ga0157372_133632101 106
49 3300025911 Ga0207654_10140609 Ga0207654_101406092 106
50 3300025911 Ga0207654_10324491 Ga0207654_103244912 106
51 3300025912 Ga0207707_10127029 Ga0207707_101270291 106
52 3300025921 Ga0207652_10404395 Ga0207652_104043953 106
53 3300025949 Ga0207667_10000278 Ga0207667_1000027849 106
54 3300025949 Ga0207667_10997351 Ga0207667_109973512 106
55 3300026116 Ga0207674_10401683 Ga0207674_104016832 106
56 3300028558 Ga0265326_10003117 Ga0265326_100031175 106
57 3300028654 Ga0265322_10001239 Ga0265322_100012393 106
58 3300028800 Ga0265338_10457892 Ga0265338_104578922 106
59 3300031249 Ga0265339_10114825 Ga0265339_101148252 106
60 3300050494 nmdc:mga06z11_13768_c1 nmdc:mga06z11_13768_c1_1471_1794 106
61 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_176034_176363 106
62 3300053103 Ga0500555_000001 Ga0500555_000001_107239_107568 106
63 3300053117 Ga0500593_000001 Ga0500593_000001_193575_193925 106
64 3300005329 Ga0070683_100009101 Ga0070683_1000091011 108
65 3300005535 Ga0070684_100003232 Ga0070684_10000323212 108
66 3300025944 Ga0207661_10000526 Ga0207661_1000052619 108
67 3300009545 Ga0105237_12686066 Ga0105237_126860661 111
68 3300030745 Ga0316182_1080972 Ga0316182_10809722 111
69 3300041512 Ga0451853_2166348 Ga0451853_2166348_44_379 111
70 3300053104 Ga0500556_0252964 Ga0500556_0252964_310_645 111
71 2162886012 MBSR1b_contig_12120710 MBSR1b_0776.00006170 112
72 2162886012 MBSR1b_contig_1226760 MBSR1b_0699.00003480 112
73 3300003316 rootH1_10003685 rootH1_1000368516 112
74 3300003320 rootH2_10008921 rootH2_100089215 112
75 3300003323 rootH1_10001727 rootH1_1000172776 112
76 3300003323 rootH1_10379776 rootH1_103797762 112
77 3300003911 JGI25405J52794_10005825 JGI25405J52794_100058252 112
78 3300005293 Ga0065715_10090517 Ga0065715_100905174 112
79 3300005338 Ga0068868_100549775 Ga0068868_1005497751 112
80 3300005339 Ga0070660_100312165 Ga0070660_1003121652 112
81 3300005563 Ga0068855_100000002 Ga0068855_100000002598 112
82 3300005577 Ga0068857_100086990 Ga0068857_1000869905 112
83 3300005578 Ga0068854_100195434 Ga0068854_1001954341 112
84 3300005614 Ga0068856_100095746 Ga0068856_1000957463 112
85 3300005937 Ga0081455_10000006 Ga0081455_10000006276 112
86 3300006038 Ga0075365_10000005 Ga0075365_10000005104 112
87 3300006038 Ga0075365_10000113 Ga0075365_1000011326 112
88 3300006038 Ga0075365_10001282 Ga0075365_100012823 112
89 3300006038 Ga0075365_10005326 Ga0075365_100053263 112
90 3300006042 Ga0075368_10000664 Ga0075368_1000066411 112
91 3300006048 Ga0075363_100241895 Ga0075363_1002418952 112
92 3300006051 Ga0075364_10000166 Ga0075364_1000016624 112
93 3300006051 Ga0075364_10222874 Ga0075364_102228741 112
94 3300006177 Ga0075362_10125130 Ga0075362_101251302 112
95 3300006186 Ga0075369_10003077 Ga0075369_1000307710 112
96 3300006353 Ga0075370_10006167 Ga0075370_100061677 112
97 3300009093 Ga0105240_10000030 Ga0105240_10000030285 112
98 3300009093 Ga0105240_10813940 Ga0105240_108139402 112
99 3300009545 Ga0105237_10000001 Ga0105237_1000000190 112
100 3300009979 Ga0105032_100002 Ga0105032_100002322 112
101 3300009979 Ga0105032_100010 Ga0105032_1000104 112
102 3300012500 Ga0157314_1005911 Ga0157314_10059112 112
103 3300013102 Ga0157371_10088640 Ga0157371_100886404 112
104 3300013102 Ga0157371_10361265 Ga0157371_103612652 112
105 3300013104 Ga0157370_10000232 Ga0157370_1000023221 112
106 3300013105 Ga0157369_10000003 Ga0157369_1000000377 112
107 3300013105 Ga0157369_11561551 Ga0157369_115615512 112
108 3300013296 Ga0157374_10160676 Ga0157374_101606762 112
109 3300013307 Ga0157372_10000007 Ga0157372_1000000790 112
110 3300025913 Ga0207695_10000009 Ga0207695_1000000991 112
111 3300025913 Ga0207695_10571425 Ga0207695_105714252 112
112 3300025914 Ga0207671_10000003 Ga0207671_1000000391 112
113 3300025919 Ga0207657_10035664 Ga0207657_100356646 112
114 3300025949 Ga0207667_10000005 Ga0207667_10000005708 112
115 3300025981 Ga0207640_10174112 Ga0207640_101741121 112
116 3300026023 Ga0207677_11061565 Ga0207677_110615651 112
117 3300026078 Ga0207702_10119014 Ga0207702_101190143 112
118 3300026116 Ga0207674_10105441 Ga0207674_101054412 112
119 3300027866 Ga0209813_10000186 Ga0209813_1000018616 112
120 3300030731 Ga0316177_1189579 Ga0316177_11895792 112
121 3300030733 Ga0314311_1150615 Ga0314311_11506155 112
122 3300030733 Ga0314311_1244209 Ga0314311_12442092 112
123 3300030734 Ga0316179_1056598 Ga0316179_105659810 112
124 3300030736 Ga0316180_1029413 Ga0316180_10294135 112
125 3300030742 Ga0316183_1008390 Ga0316183_10083903 112
126 3300030742 Ga0316183_1024804 Ga0316183_10248043 112
127 3300030742 Ga0316183_1114883 Ga0316183_111488338 112
128 3300030742 Ga0316183_1183010 Ga0316183_11830103 112
129 3300030744 Ga0316181_1069799 Ga0316181_10697992 112
130 3300030744 Ga0316181_1123581 Ga0316181_112358187 112
131 3300030744 Ga0316181_1259951 Ga0316181_12599512 112
132 3300030745 Ga0316182_1010237 Ga0316182_10102377 112
133 3300030745 Ga0316182_1018373 Ga0316182_10183739 112
134 3300030745 Ga0316182_1234581 Ga0316182_123458121 112
135 3300030745 Ga0316182_1448605 Ga0316182_14486055 112
136 3300031731 Ga0307405_10083314 Ga0307405_100833142 112
137 3300031911 Ga0307412_10002279 Ga0307412_1000227911 112
138 3300041410 Ga0439461_0032022 Ga0439461_0032022_345_683 112
139 3300041410 Ga0439461_0210544 Ga0439461_0210544_133_471 112
140 3300042016 Ga0439463_029630 Ga0439463_029630_609_947 112
141 3300042122 Ga0450920_001428 Ga0450920_001428_149_487 112
142 3300042145 Ga0450906_004889 Ga0450906_004889_2394_2732 112
143 3300042147 Ga0450910_006352 Ga0450910_006352_1066_1404 112
144 3300042156 Ga0439446_0000002 Ga0439446_0000002_84892_85230 112
145 3300042185 Ga0450909_007326 Ga0450909_007326_308_646 112
146 3300042185 Ga0450909_062628 Ga0450909_062628_48_386 112
147 3300042435 Ga0439434_0017078 Ga0439434_0017078_735_1073 112
148 3300042531 Ga0450918_000494 Ga0450918_000494_170_511 112
149 3300042531 Ga0450918_035738 Ga0450918_035738_264_602 112
150 3300044658 Ga0466972_0045336 Ga0466972_0045336_1772_2110 112
151 3300044683 Ga0466965_0000207 Ga0466965_0000207_15696_16034 112
152 3300044735 Ga0466968_0552719 Ga0466968_0552719_223_561 112
153 3300044765 Ga0466970_0165600 Ga0466970_0165600_77_418 112
154 3300046810 Ga0495660_0000114 Ga0495660_0000114_2554_2892 112
155 3300046810 Ga0495660_0331437 Ga0495660_0331437_231_569 112
156 3300047322 Ga0495680_0571403 Ga0495680_0571403_329_667 112
157 3300048903 Ga0496100_0011723 Ga0496100_0011723_3864_4202 112
158 3300049589 Ga0501073_0815171 Ga0501073_0815171_133_471 112
159 3300049663 Ga0501223_049773 Ga0501223_049773_411_749 112
160 3300050489 nmdc:mga03683_7097_c1 nmdc:mga03683_7097_c1_307_645 112
161 3300050490 nmdc:mga03n38_6386_c2 nmdc:mga03n38_6386_c2_1605_1943 112
162 3300050491 nmdc:mga00v17_128_c1 nmdc:mga00v17_128_c1_19929_20267 112
163 3300050492 nmdc:mga0yw44_1016554_c1 nmdc:mga0yw44_1016554_c1_17_355 112
164 3300050492 nmdc:mga0yw44_11_c1 nmdc:mga0yw44_11_c1_72923_73261 112
165 3300050492 nmdc:mga0yw44_1238_c1 nmdc:mga0yw44_1238_c1_3853_4191 112
166 3300050492 nmdc:mga0yw44_5963_c1 nmdc:mga0yw44_5963_c1_4590_4928 112
167 3300050492 nmdc:mga0yw44_5_c1 nmdc:mga0yw44_5_c1_185380_185718 112
168 3300050494 nmdc:mga06z11_151_c1 nmdc:mga06z11_151_c1_26225_26563 112
169 3300050495 nmdc:mga04h51_213_c1 nmdc:mga04h51_213_c1_3716_4054 112
170 3300050496 nmdc:mga07m45_14804_c1 nmdc:mga07m45_14804_c1_1013_1351 112
171 3300050496 nmdc:mga07m45_271209_c1 nmdc:mga07m45_271209_c1_631_969 112
172 3300050516 nmdc:mga0sz30_1649_c1 nmdc:mga0sz30_1649_c1_244_582 112
173 3300053087 Ga0500643_005181 Ga0500643_005181_1779_2120 112
174 3300053088 Ga0500644_0005371 Ga0500644_0005371_419_757 112
175 3300053092 Ga0500583_0004275 Ga0500583_0004275_1845_2183 112
176 3300053092 Ga0500583_0016445 Ga0500583_0016445_1763_2101 112
177 3300053093 Ga0500651_0000021 Ga0500651_0000021_8285_8626 112
178 3300053098 Ga0500650_0166220 Ga0500650_0166220_283_621 112
179 3300053103 Ga0500555_000045 Ga0500555_000045_16667_17008 112
180 3300053118 Ga0500594_0000106 Ga0500594_0000106_15771_16112 112
181 3300053133 Ga0500655_000068 Ga0500655_000068_12056_12394 112
182 3300053142 Ga0500577_0080721 Ga0500577_0080721_157_495 112
183 3300053153 Ga0500616_0000012 Ga0500616_0000012_14968_15306 112
184 3300053153 Ga0500616_0029620 Ga0500616_0029620_2367_2705 112
185 3300053724 Ga0500570_000807 Ga0500570_000807_6705_7046 112
186 3300053724 Ga0500570_065853 Ga0500570_065853_39_377 112
187 3300053724 Ga0500570_139073 Ga0500570_139073_341_679 112
188 3300053727 Ga0500611_104695 Ga0500611_104695_302_649 112
189 3300053738 Ga0500613_006730 Ga0500613_006730_697_1035 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

16

113

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9314 2 112
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9077 2 112
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7852 1 111
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7783 1 109
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7535 1 109
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9314 2 112 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9136 1 111 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9077 2 112 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8953 3 111 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8519 1 111 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W1KH19-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9622 1 109 GO:0003677
AF-A0A2E4GVS0-F1-model_v4 MmcQ-like protein 0.9588 1 111
AF-A0A1E4ARE3-F1-model_v4 deleted 0.9577 1 111
AF-A0A7W0RZV6-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9569 2 111 GO:0003677
AF-A0A2G6C2F8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9567 13 111

Feature Viewer

pLDDT pTM Quality
90.04 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map