F290536

General Info

Members Datasets Scaffolds Average Seq Length
189 132 378 237

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100080654|Ga0070708_1000806544
Length 265
Sequence MFHMRSKSPDARSESLPQSLAKSEPTKQSASARGSRPDPVLITPNYLRHAEGSALITVGLTRVLCAASVEEGVPPFLRGSGRGWVTAEYGMLPRSTHTRSDREAARGRVGGRTHEIQRLIGRSLRAVTDLAVLGERTIWIDCDVIEADGGTRTAAITGAYVALALAVRTLEASGTALGGPVLRDAVAAVSVGLVDRRLCLDLAYVEDSRAEVDMNVVMTGQGRFVEVQGTAEAKPFTAAQLARMTALAADGIKQLITIQRETLGD

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
81 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
82 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 3.17
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100080654 3300005445 Bacteria 2945
2 Ga0065714_10163474 3300005288 Bacteria 1000
3 Ga0065707_10119780 3300005295 Bacteria 2151
4 Ga0070676_10030367 3300005328 Bacteria 3082
5 Ga0070660_100096825 3300005339 Bacteria 2334
6 Ga0070689_100105470 3300005340 Bacteria 2235
7 Ga0070668_100313545 3300005347 Bacteria 1319
8 Ga0070675_100020805 3300005354 Bacteria 5236
9 Ga0070673_100179107 3300005364 Bacteria 1814
10 Ga0070659_100154866 3300005366 Bacteria 1871
11 Ga0070667_100520774 3300005367 Bacteria 1091
12 Ga0070703_10000276 3300005406 Bacteria 24391
13 Ga0070709_10000003 3300005434 Bacteria 295541
14 Ga0070711_100000061 3300005439 Bacteria 64645
15 Ga0070705_100000245 3300005440 Bacteria 32243
16 Ga0070705_100036754 3300005440 Bacteria 2756
17 Ga0070700_100091601 3300005441 Bacteria 1985
18 Ga0070708_100350708 3300005445 Bacteria 1391
19 Ga0070706_100116171 3300005467 Bacteria 2492
20 Ga0070706_100835585 3300005467 Bacteria 852
21 Ga0070699_100000009 3300005518 Bacteria 272902
22 Ga0070699_100193202 3300005518 Bacteria 1809
23 Ga0070699_100503717 3300005518 Bacteria 1100
24 Ga0070697_100182765 3300005536 Bacteria 1778
25 Ga0070672_100347057 3300005543 Bacteria 1265
26 Ga0070696_100045283 3300005546 Bacteria 3048
27 Ga0070696_100054382 3300005546 Bacteria 2789
28 Ga0070696_100179917 3300005546 Bacteria 1568
29 Ga0070704_100038233 3300005549 Bacteria 3286
30 Ga0070704_100259152 3300005549 Bacteria 1432
31 Ga0068857_100081916 3300005577 Bacteria 2882
32 Ga0068860_100003186 3300005843 Bacteria 16928
33 Ga0075428_100001056 3300006844 Bacteria 29277
34 Ga0075428_100049480 3300006844 Bacteria 4611
35 Ga0075428_100610406 3300006844 Bacteria 1165
36 Ga0075428_100706439 3300006844 Bacteria 1074
37 Ga0075430_100053719 3300006846 Bacteria 3392
38 Ga0075431_100001293 3300006847 Bacteria 22854
39 Ga0075431_100002086 3300006847 Bacteria 19086
40 Ga0075433_10031186 3300006852 Bacteria 4555
41 Ga0075434_100027964 3300006871 Bacteria 5536
42 Ga0075434_100541829 3300006871 Bacteria 1184
43 Ga0075436_100013111 3300006914 Bacteria 5682
44 Ga0075436_100197783 3300006914 Bacteria 1423
45 Ga0075435_100223470 3300007076 Bacteria 1599
46 Ga0111539_10001304 3300009094 Bacteria 33303
47 Ga0114129_10042928 3300009147 Bacteria 6364
48 Ga0114129_10095533 3300009147 Bacteria 4117
49 Ga0114129_10411830 3300009147 Bacteria 1780
50 Ga0114129_11045214 3300009147 Bacteria 1026
51 Ga0114129_11604011 3300009147 Bacteria 797
52 Ga0157370_10010275 3300013104 Bacteria 9883
53 Ga0157370_10062231 3300013104 Bacteria 3540
54 Ga0157380_10044688 3300014326 Bacteria 3473
55 Ga0157379_10000178 3300014968 Bacteria 47965
56 Ga0207653_10000081 3300025885 Bacteria 69110
57 Ga0207692_10187357 3300025898 Bacteria 1209
58 Ga0207699_10000006 3300025906 Bacteria 430147
59 Ga0207645_10114100 3300025907 Bacteria 1751
60 Ga0207684_10000161 3300025910 Bacteria 114989
61 Ga0207693_10038929 3300025915 Bacteria 3743
62 Ga0207663_10000005 3300025916 Bacteria 282473
63 Ga0207657_10102450 3300025919 Bacteria 2374
64 Ga0207650_10063332 3300025925 Bacteria 2765
65 Ga0207659_10173446 3300025926 Bacteria 1703
66 Ga0207644_10066955 3300025931 Bacteria 2617
67 Ga0207665_10351121 3300025939 Bacteria 1113
68 Ga0207691_10170893 3300025940 Bacteria 1903
69 Ga0207651_10136384 3300025960 Bacteria 1888
70 Ga0207658_10167850 3300025986 Bacteria 1805
71 Ga0207658_10294872 3300025986 Bacteria 1395
72 Ga0207674_10040176 3300026116 Unclassified 4848
73 Ga0207428_10001029 3300027907 Bacteria 30783
74 Ga0265323_10054059 3300028653 Bacteria 1416
75 Ga0265338_10049539 3300028800 Bacteria 3807
76 Ga0265760_10000013 3300031090 Bacteria 98018
77 Ga0265760_10074788 3300031090 Bacteria 1043
78 Ga0265330_10021438 3300031235 Bacteria 2949
79 Ga0265332_10000850 3300031238 Bacteria 18518
80 Ga0265329_10014179 3300031242 Bacteria 2818
81 Ga0265329_10020319 3300031242 Bacteria 2244
82 Ga0265339_10045834 3300031249 Bacteria 2405
83 Ga0265331_10000332 3300031250 Bacteria 50625
84 Ga0265316_10000377 3300031344 Bacteria 50623
85 Ga0307408_100045547 3300031548 Bacteria 3134
86 Ga0307408_100064283 3300031548 Bacteria 2687
87 Ga0265314_10000501 3300031711 Bacteria 50623
88 Ga0316576_10004410 3300031727 Bacteria 8430
89 Ga0307410_10064736 3300031852 Bacteria 2513
90 Ga0307406_10283324 3300031901 Bacteria 1265
91 Ga0307409_100117458 3300031995 Bacteria 2245
92 Ga0307416_100079092 3300032002 Bacteria 2770
93 Ga0373949_0182809 3300035090 Bacteria 622
94 Ga0373954_0202599 3300035118 Bacteria 975
95 Ga0373931_0077125 3300035691 Bacteria 1832
96 Ga0373935_0014106 3300035692 Bacteria 4825
97 Ga0373927_0068978 3300035695 Bacteria 2288
98 Ga0373947_0066192 3300035725 Bacteria 2205
99 Ga0373947_0089978 3300035725 Bacteria 1912
100 Ga0373937_0934732 3300036401 Bacteria 816
101 Ga0373925_0011051 3300037068 Bacteria 6557
102 Ga0436362_0722331 3300039453 Bacteria 1217
103 Ga0451853_3534492 3300041512 Bacteria 889
104 Ga0450895_002134 3300042132 Bacteria 1446
105 Ga0439435_0055256 3300042436 Bacteria 1145
106 Ga0450918_004655 3300042531 Bacteria 2489
107 Ga0451577_0125711 3300042876 Bacteria 2298
108 Ga0453684_0048365 3300044712 Bacteria 5626
109 Ga0453684_0358156 3300044712 Bacteria 1643
110 Ga0451576_0000536 3300045051 Bacteria 81835
111 Ga0451576_0007291 3300045051 Bacteria 13284
112 Ga0466967_0272074 3300045976 Bacteria 1623
113 Ga0495603_0384342 3300046455 Bacteria 805
114 Ga0495653_0094408 3300046463 Bacteria 2179
115 Ga0495580_0007644 3300046472 Bacteria 8669
116 Ga0495656_0000012 3300046615 Bacteria 137678
117 Ga0495659_0005721 3300046664 Bacteria 3918
118 Ga0495659_0007569 3300046664 Bacteria 3444
119 Ga0495600_0353838 3300046809 Bacteria 920
120 Ga0495604_0033688 3300047317 Bacteria 4054
121 Ga0496101_0003370 3300048904 Bacteria 9961
122 Ga0496105_0028609 3300048908 Bacteria 4558
123 Ga0496107_0010865 3300048910 Bacteria 6335
124 Ga0496108_0442779 3300048911 Bacteria 1135
125 Ga0496109_0243823 3300048912 Bacteria 1692
126 Ga0496115_0002370 3300048918 Bacteria 13513
127 Ga0501031_0028065 3300049568 Bacteria 3668
128 Ga0501032_0128424 3300049569 Bacteria 1673
129 Ga0501034_0295849 3300049571 Bacteria 1556
130 Ga0501037_0068766 3300049573 Bacteria 2579
131 Ga0501040_0180664 3300049576 Bacteria 1496
132 Ga0501041_0349113 3300049577 Bacteria 935
133 Ga0501041_0389284 3300049577 Bacteria 882
134 Ga0501043_0193583 3300049579 Bacteria 1581
135 Ga0501043_0955908 3300049579 Bacteria 612
136 Ga0501046_0054754 3300049580 Bacteria 3137
137 Ga0501046_0065501 3300049580 Bacteria 2834
138 Ga0501046_0219795 3300049580 Bacteria 1407
139 Ga0501070_0011595 3300049586 Bacteria 7442
140 Ga0501071_0110832 3300049587 Bacteria 2028
141 Ga0501072_0079395 3300049588 Bacteria 2599
142 Ga0501073_0090437 3300049589 Bacteria 2127
143 Ga0501073_0194711 3300049589 Bacteria 1402
144 Ga0501074_0290982 3300049590 Bacteria 1161
145 Ga0501075_0034758 3300049591 Bacteria 3754
146 Ga0501075_0107258 3300049591 Bacteria 2123
147 Ga0501075_0179858 3300049591 Bacteria 1614
148 Ga0501075_0488554 3300049591 Bacteria 939
149 Ga0501076_0101548 3300049592 Bacteria 2318
150 Ga0501077_0032568 3300049593 Bacteria 3318
151 Ga0501077_0059103 3300049593 Bacteria 2434
152 Ga0501077_0351442 3300049593 Bacteria 941
153 Ga0501079_0001189 3300049741 Bacteria 18236
154 Ga0501079_0028529 3300049741 Bacteria 4283
155 Ga0501079_0181146 3300049741 Bacteria 1644
156 Ga0501079_0517549 3300049741 Bacteria 938
157 Ga0501080_0001126 3300049742 Bacteria 21986
158 Ga0501080_0091991 3300049742 Bacteria 2817
159 Ga0501080_0286457 3300049742 Bacteria 1497
160 Ga0501081_0146356 3300049743 Bacteria 1696
161 Ga0501081_0399760 3300049743 Bacteria 1017
162 Ga0501045_0163476 3300049824 Bacteria 1657
163 nmdc:mga0k408_38571_c1 3300050493 Bacteria 2742
164 nmdc:mga05p37_16716_c1 3300050507 Bacteria 8843
165 nmdc:mga05p37_799319_c1 3300050507 Bacteria 1032
166 nmdc:mga05p37_98464_c2 3300050507 Bacteria 2991
167 nmdc:mga09592_19397_c1 3300050508 Bacteria 5583
168 nmdc:mga0qj67_42421_c1 3300050509 Bacteria 3581
169 nmdc:mga06r32_18811_c1 3300050510 Bacteria 6330
170 nmdc:mga06r32_201_c1 3300050510 Bacteria 26944
171 nmdc:mga08y16_218410_c1 3300050511 Bacteria 1974
172 nmdc:mga08y16_913_c1 3300050511 Bacteria 28616
173 nmdc:mga0n895_25949_c1 3300050512 Bacteria 5542
174 nmdc:mga0n895_412037_c1 3300050512 Bacteria 1366
175 nmdc:mga0n895_606360_c1 3300050512 Bacteria 1097
176 nmdc:mga08x19_20_c1 3300050514 Bacteria 304974
177 nmdc:mga08x19_22710_c1 3300050514 Bacteria 3886
178 nmdc:mga08x19_319052_c1 3300050514 Bacteria 1081
179 nmdc:mga0a205_160340_c1 3300050515 Bacteria 2146
180 nmdc:mga0a205_22865_c1 3300050515 Bacteria 5927
181 nmdc:mga0a205_52385_c1 3300050515 Bacteria 3938
182 Ga0495619_0536958 3300053085 Bacteria 803
183 Ga0501084_0112232 3300054114 Bacteria 2290
184 Ga0501082_0023018 3300060353 Bacteria 5371
185 Ga0501082_0084683 3300060353 Bacteria 2734
186 Ga0501082_0183810 3300060353 Bacteria 1819
187 Ga0501082_0265084 3300060353 Bacteria 1495
188 Ga0530510_0071003 3300061734 Bacteria 2527
189 Ga0530510_0560775 3300061734 Bacteria 868
190 Ga0070708_100080654
191 Ga0065714_10163474
192 Ga0065707_10119780
193 Ga0070676_10030367
194 Ga0070660_100096825
195 Ga0070689_100105470
196 Ga0070668_100313545
197 Ga0070675_100020805
198 Ga0070673_100179107
199 Ga0070659_100154866
200 Ga0070667_100520774
201 Ga0070703_10000276
202 Ga0070709_10000003
203 Ga0070711_100000061
204 Ga0070705_100000245
205 Ga0070705_100036754
206 Ga0070700_100091601
207 Ga0070708_100350708
208 Ga0070706_100116171
209 Ga0070706_100835585
210 Ga0070699_100000009
211 Ga0070699_100193202
212 Ga0070699_100503717
213 Ga0070697_100182765
214 Ga0070672_100347057
215 Ga0070696_100045283
216 Ga0070696_100054382
217 Ga0070696_100179917
218 Ga0070704_100038233
219 Ga0070704_100259152
220 Ga0068857_100081916
221 Ga0068860_100003186
222 Ga0075428_100001056
223 Ga0075428_100049480
224 Ga0075428_100610406
225 Ga0075428_100706439
226 Ga0075430_100053719
227 Ga0075431_100001293
228 Ga0075431_100002086
229 Ga0075433_10031186
230 Ga0075434_100027964
231 Ga0075434_100541829
232 Ga0075436_100013111
233 Ga0075436_100197783
234 Ga0075435_100223470
235 Ga0111539_10001304
236 Ga0114129_10042928
237 Ga0114129_10095533
238 Ga0114129_10411830
239 Ga0114129_11045214
240 Ga0114129_11604011
241 Ga0157370_10010275
242 Ga0157370_10062231
243 Ga0157380_10044688
244 Ga0157379_10000178
245 Ga0207653_10000081
246 Ga0207692_10187357
247 Ga0207699_10000006
248 Ga0207645_10114100
249 Ga0207684_10000161
250 Ga0207693_10038929
251 Ga0207663_10000005
252 Ga0207657_10102450
253 Ga0207650_10063332
254 Ga0207659_10173446
255 Ga0207644_10066955
256 Ga0207665_10351121
257 Ga0207691_10170893
258 Ga0207651_10136384
259 Ga0207658_10167850
260 Ga0207658_10294872
261 Ga0207674_10040176
262 Ga0207428_10001029
263 Ga0265323_10054059
264 Ga0265338_10049539
265 Ga0265760_10000013
266 Ga0265760_10074788
267 Ga0265330_10021438
268 Ga0265332_10000850
269 Ga0265329_10014179
270 Ga0265329_10020319
271 Ga0265339_10045834
272 Ga0265331_10000332
273 Ga0265316_10000377
274 Ga0307408_100045547
275 Ga0307408_100064283
276 Ga0265314_10000501
277 Ga0316576_10004410
278 Ga0307410_10064736
279 Ga0307406_10283324
280 Ga0307409_100117458
281 Ga0307416_100079092
282 Ga0373949_0182809
283 Ga0373954_0202599
284 Ga0373931_0077125
285 Ga0373935_0014106
286 Ga0373927_0068978
287 Ga0373947_0066192
288 Ga0373947_0089978
289 Ga0373937_0934732
290 Ga0373925_0011051
291 Ga0436362_0722331
292 Ga0451853_3534492
293 Ga0450895_002134
294 Ga0439435_0055256
295 Ga0450918_004655
296 Ga0451577_0125711
297 Ga0453684_0048365
298 Ga0453684_0358156
299 Ga0451576_0000536
300 Ga0451576_0007291
301 Ga0466967_0272074
302 Ga0495603_0384342
303 Ga0495653_0094408
304 Ga0495580_0007644
305 Ga0495656_0000012
306 Ga0495659_0005721
307 Ga0495659_0007569
308 Ga0495600_0353838
309 Ga0495604_0033688
310 Ga0496101_0003370
311 Ga0496105_0028609
312 Ga0496107_0010865
313 Ga0496108_0442779
314 Ga0496109_0243823
315 Ga0496115_0002370
316 Ga0501031_0028065
317 Ga0501032_0128424
318 Ga0501034_0295849
319 Ga0501037_0068766
320 Ga0501040_0180664
321 Ga0501041_0349113
322 Ga0501041_0389284
323 Ga0501043_0193583
324 Ga0501043_0955908
325 Ga0501046_0054754
326 Ga0501046_0065501
327 Ga0501046_0219795
328 Ga0501070_0011595
329 Ga0501071_0110832
330 Ga0501072_0079395
331 Ga0501073_0090437
332 Ga0501073_0194711
333 Ga0501074_0290982
334 Ga0501075_0034758
335 Ga0501075_0107258
336 Ga0501075_0179858
337 Ga0501075_0488554
338 Ga0501076_0101548
339 Ga0501077_0032568
340 Ga0501077_0059103
341 Ga0501077_0351442
342 Ga0501079_0001189
343 Ga0501079_0028529
344 Ga0501079_0181146
345 Ga0501079_0517549
346 Ga0501080_0001126
347 Ga0501080_0091991
348 Ga0501080_0286457
349 Ga0501081_0146356
350 Ga0501081_0399760
351 Ga0501045_0163476
352 nmdc:mga0k408_38571_c1
353 nmdc:mga05p37_16716_c1
354 nmdc:mga05p37_799319_c1
355 nmdc:mga05p37_98464_c2
356 nmdc:mga09592_19397_c1
357 nmdc:mga0qj67_42421_c1
358 nmdc:mga06r32_18811_c1
359 nmdc:mga06r32_201_c1
360 nmdc:mga08y16_218410_c1
361 nmdc:mga08y16_913_c1
362 nmdc:mga0n895_25949_c1
363 nmdc:mga0n895_412037_c1
364 nmdc:mga0n895_606360_c1
365 nmdc:mga08x19_20_c1
366 nmdc:mga08x19_22710_c1
367 nmdc:mga08x19_319052_c1
368 nmdc:mga0a205_160340_c1
369 nmdc:mga0a205_22865_c1
370 nmdc:mga0a205_52385_c1
371 Ga0495619_0536958
372 Ga0501084_0112232
373 Ga0501082_0023018
374 Ga0501082_0084683
375 Ga0501082_0183810
376 Ga0501082_0265084
377 Ga0530510_0071003
378 Ga0530510_0560775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03725

RNase_PH_C

3' exoribonuclease family, domain 2

184

251

0.96

PF01138

RNase_PH

3' exoribonuclease family, domain 1

38

169

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oyr-assembly1.cif.gz_C crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis 0.9675 9 238
3dd6-assembly1.cif.gz_A crystal structure of rph, an exoribonuclease from bacillus anthracis at 1.7 a resolution 0.9662 9 238
1oyp-assembly1.cif.gz_A crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis 0.9578 1 238
1udn-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph from aquifex aeolicus 0.9533 8 234
1uds-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph r126a mutant from aquifex aeolicus 0.9525 8 234
ID Description Score Start End Superfamily
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9792 15 236 3.30.230.70
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9697 15 236 3.30.230.70
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.968 15 238 3.30.230.70
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9313 15 238 3.30.230.70
af_Q9VGZ2_13_218_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9285 12 237 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A3D0N2R5-F1-model_v4 Ribonuclease PH 0.9961 117 238 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A3D1J113-F1-model_v4 Ribonuclease PH 0.9958 117 237 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A0B0CUI5-F1-model_v4 Ribonuclease PH 0.9948 87 238 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A3D4G1B9-F1-model_v4 Ribonuclease PH 0.9947 84 237 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075
AF-A0A7V1D542-F1-model_v4 Ribonuclease PH 0.9946 117 237 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075

Map