F290431

General Info

Members Datasets Scaffolds Average Seq Length
189 92 378 113

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100214362|Ga0068868_1002143623
Length 103
Sequence MASIFTKIINKEIPAKIEFEDELCIVIHDIHPKAPVHLLIIPKKEIATIMDVQDEDQTLLGHLMLVARNMGKKMGLEGYKLVYNVGHKGGQEVFHIHLHLMGG

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
87 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100214362 3300005338 Bacteria 1610
2 rootL2_10192772 3300003322 Bacteria 1711
3 rootH1_10194539 3300003323 Unclassified 1470
4 Ga0070683_100005068 3300005329 Bacteria 10941
5 Ga0068869_100000006 3300005334 Bacteria 87287
6 Ga0068868_100230921 3300005338 Bacteria 1552
7 Ga0070713_100235930 3300005436 Bacteria 1664
8 Ga0068867_100001137 3300005459 Bacteria 18183
9 Ga0070686_100695666 3300005544 Bacteria 810
10 Ga0070664_101466427 3300005564 Bacteria 645
11 Ga0068856_100121856 3300005614 Bacteria 2610
12 Ga0068859_101182656 3300005617 Bacteria 842
13 Ga0070717_10000023 3300006028 Bacteria 159544
14 Ga0070717_10434879 3300006028 Bacteria 1181
15 Ga0097621_100004751 3300006237 Bacteria 9501
16 Ga0068871_100010087 3300006358 Bacteria 6873
17 Ga0068865_100006518 3300006881 Bacteria 7129
18 Ga0097620_101182685 3300006931 Bacteria 842
19 Ga0105240_10886000 3300009093 Bacteria 961
20 Ga0111539_12714037 3300009094 Bacteria 574
21 Ga0105243_10127302 3300009148 Bacteria 2157
22 Ga0157378_11114710 3300013297 Bacteria 826
23 Ga0163163_10126446 3300014325 Unclassified 2594
24 Ga0163163_11188626 3300014325 Bacteria 825
25 Ga0157376_11517470 3300014969 Bacteria 703
26 Ga0207662_10210083 3300025918 Bacteria 1263
27 Ga0207700_10198834 3300025928 Bacteria 1688
28 Ga0207704_10016817 3300025938 Bacteria 3771
29 Ga0207691_11117441 3300025940 Unclassified 655
30 Ga0207689_10000034 3300025942 Bacteria 95262
31 Ga0207661_10170123 3300025944 Bacteria 1896
32 Ga0207679_11089197 3300025945 Bacteria 733
33 Ga0207677_10015593 3300026023 Bacteria 4476
34 Ga0207677_10152879 3300026023 Bacteria 1783
35 Ga0207677_10240414 3300026023 Bacteria 1464
36 Ga0207648_10047377 3300026089 Bacteria 3768
37 Ga0207674_12027923 3300026116 Bacteria 540
38 Ga0265337_1001207 3300028556 Bacteria 13151
39 Ga0265337_1010436 3300028556 Bacteria 3253
40 Ga0265337_1024543 3300028556 Bacteria 1843
41 Ga0265337_1032564 3300028556 Bacteria 1541
42 Ga0265319_1002208 3300028563 Bacteria 10834
43 Ga0265319_1005892 3300028563 Bacteria 5767
44 Ga0265319_1028170 3300028563 Bacteria 1983
45 Ga0265319_1078798 3300028563 Bacteria 1048
46 Ga0265319_1123198 3300028563 Bacteria 807
47 Ga0265334_10009440 3300028573 Bacteria 4125
48 Ga0265334_10019052 3300028573 Bacteria 2826
49 Ga0265334_10088595 3300028573 Bacteria 1132
50 Ga0265334_10298974 3300028573 Unclassified 551
51 Ga0265318_10000422 3300028577 Bacteria 32552
52 Ga0265318_10003010 3300028577 Bacteria 8695
53 Ga0265323_10000032 3300028653 Bacteria 76562
54 Ga0265323_10001410 3300028653 Bacteria 11829
55 Ga0265323_10004295 3300028653 Bacteria 6151
56 Ga0265323_10004441 3300028653 Bacteria 6046
57 Ga0265323_10007823 3300028653 Bacteria 4420
58 Ga0265323_10015442 3300028653 Bacteria 3003
59 Ga0265323_10042289 3300028653 Bacteria 1651
60 Ga0265323_10044894 3300028653 Bacteria 1590
61 Ga0265323_10095071 3300028653 Bacteria 992
62 Ga0265322_10000889 3300028654 Bacteria 10597
63 Ga0265322_10048066 3300028654 Unclassified 1212
64 Ga0265336_10005034 3300028666 Bacteria 4921
65 Ga0265338_10000919 3300028800 Bacteria 49615
66 Ga0265338_10045130 3300028800 Bacteria 4057
67 Ga0265338_10372389 3300028800 Bacteria 1023
68 Ga0265338_10610383 3300028800 Unclassified 759
69 Ga0265338_10691264 3300028800 Bacteria 705
70 Ga0265324_10000442 3300029957 Bacteria 29455
71 Ga0265324_10007087 3300029957 Bacteria 4593
72 Ga0265324_10032842 3300029957 Bacteria 1813
73 Ga0265330_10061998 3300031235 Bacteria 1626
74 Ga0265330_10078400 3300031235 Bacteria 1425
75 Ga0265330_10283270 3300031235 Unclassified 698
76 Ga0265332_10012870 3300031238 Bacteria 3711
77 Ga0265332_10132734 3300031238 Bacteria 1044
78 Ga0265328_10011886 3300031239 Bacteria 3472
79 Ga0265328_10085885 3300031239 Bacteria 1161
80 Ga0265320_10000430 3300031240 Bacteria 33126
81 Ga0265320_10004400 3300031240 Bacteria 9237
82 Ga0265320_10015553 3300031240 Bacteria 4297
83 Ga0265320_10029684 3300031240 Bacteria 2827
84 Ga0265320_10049523 3300031240 Bacteria 2045
85 Ga0265320_10113036 3300031240 Bacteria 1243
86 Ga0265320_10146461 3300031240 Bacteria 1068
87 Ga0265325_10028951 3300031241 Bacteria 2980
88 Ga0265329_10050744 3300031242 Unclassified 1321
89 Ga0265329_10101094 3300031242 Bacteria 918
90 Ga0265329_10235527 3300031242 Bacteria 608
91 Ga0265340_10023645 3300031247 Bacteria 3131
92 Ga0265340_10390209 3300031247 Bacteria 614
93 Ga0265339_10014231 3300031249 Bacteria 4800
94 Ga0265339_10108018 3300031249 Bacteria 1443
95 Ga0265339_10288409 3300031249 Bacteria 785
96 Ga0265331_10235231 3300031250 Bacteria 822
97 Ga0265331_10432052 3300031250 Bacteria 591
98 Ga0265327_10020356 3300031251 Bacteria 4046
99 Ga0265327_10041586 3300031251 Bacteria 2475
100 Ga0265316_10006352 3300031344 Bacteria 11304
101 Ga0265316_10014232 3300031344 Bacteria 7016
102 Ga0265316_10018641 3300031344 Bacteria 5961
103 Ga0265316_10022322 3300031344 Bacteria 5338
104 Ga0265316_10024767 3300031344 Bacteria 5017
105 Ga0265316_10035011 3300031344 Bacteria 4075
106 Ga0265316_10083805 3300031344 Bacteria 2442
107 Ga0265316_10120295 3300031344 Bacteria 1983
108 Ga0265316_10305498 3300031344 Bacteria 1158
109 Ga0265316_10658933 3300031344 Unclassified 740
110 Ga0265316_10797502 3300031344 Bacteria 662
111 Ga0307509_10401986 3300031507 Bacteria 1076
112 Ga0307408_100000009 3300031548 Bacteria 426576
113 Ga0265313_10000484 3300031595 Bacteria 41826
114 Ga0265313_10001463 3300031595 Bacteria 22030
115 Ga0265313_10003264 3300031595 Bacteria 13320
116 Ga0265313_10004532 3300031595 Bacteria 10606
117 Ga0265313_10011828 3300031595 Bacteria 5395
118 Ga0265314_10002903 3300031711 Bacteria 17004
119 Ga0265314_10027382 3300031711 Bacteria 4268
120 Ga0265314_10078015 3300031711 Unclassified 2195
121 Ga0265314_10462731 3300031711 Bacteria 674
122 Ga0265314_10648493 3300031711 Bacteria 539
123 Ga0265314_10688625 3300031711 Bacteria 518
124 Ga0265342_10003050 3300031712 Bacteria 14011
125 Ga0265342_10025901 3300031712 Bacteria 3681
126 Ga0265342_10027804 3300031712 Bacteria 3528
127 Ga0265342_10067950 3300031712 Bacteria 2084
128 Ga0265342_10094647 3300031712 Bacteria 1709
129 Ga0265342_10364269 3300031712 Unclassified 751
130 Ga0265342_10365174 3300031712 Unclassified 750
131 Ga0307413_10144926 3300031824 Unclassified 1647
132 Ga0307413_10227256 3300031824 Bacteria 1368
133 Ga0307410_10000159 3300031852 Bacteria 24412
134 Ga0307409_100000062 3300031995 Bacteria 39648
135 Ga0307409_101820641 3300031995 Bacteria 638
136 Ga0307416_100000018 3300032002 Bacteria 200227
137 Ga0307416_100346161 3300032002 Bacteria 1502
138 Ga0307414_10097258 3300032004 Bacteria 2205
139 Ga0373939_0250198 3300035114 Bacteria 689
140 Ga0373935_0198991 3300035692 Bacteria 1384
141 Ga0373933_0146389 3300035724 Bacteria 1494
142 Ga0395905_0000064 3300037471 Bacteria 186494
143 Ga0395905_0286649 3300037471 Bacteria 1534
144 Ga0439443_018528 3300042003 Bacteria 1078
145 Ga0451577_0002218 3300042876 Bacteria 23661
146 Ga0451577_0033618 3300042876 Bacteria 4623
147 Ga0451577_0143666 3300042876 Bacteria 2145
148 Ga0451577_1074577 3300042876 Bacteria 721
149 Ga0453683_0000626 3300044673 Bacteria 38554
150 Ga0453683_0216138 3300044673 Bacteria 1218
151 Ga0453683_0241554 3300044673 Bacteria 1150
152 Ga0453684_0001461 3300044712 Bacteria 66929
153 Ga0453684_0036594 3300044712 Bacteria 6762
154 Ga0453684_0118813 3300044712 Bacteria 3197
155 Ga0453684_0484702 3300044712 Bacteria 1371
156 Ga0453684_1337939 3300044712 Bacteria 745
157 Ga0453684_1339531 3300044712 Bacteria 745
158 Ga0451576_0000269 3300045051 Bacteria 127079
159 Ga0451576_0000396 3300045051 Bacteria 101504
160 Ga0451576_0014056 3300045051 Bacteria 8920
161 Ga0451576_0067253 3300045051 Bacteria 3729
162 Ga0451576_0800906 3300045051 Bacteria 989
163 Ga0495636_0089605 3300047318 Bacteria 1334
164 Ga0501031_0019745 3300049568 Bacteria 4391
165 Ga0501032_0001667 3300049569 Bacteria 17644
166 Ga0501033_0049355 3300049570 Bacteria 3123
167 Ga0501034_0062976 3300049571 Bacteria 3723
168 Ga0501036_0002704 3300049572 Bacteria 14002
169 Ga0501038_0016933 3300049574 Bacteria 6596
170 Ga0501039_0139340 3300049575 Bacteria 1905
171 Ga0501042_0032053 3300049578 Bacteria 3719
172 Ga0501043_0283106 3300049579 Bacteria 1270
173 Ga0501043_0355424 3300049579 Bacteria 1112
174 Ga0501043_0420713 3300049579 Bacteria 1007
175 Ga0501046_0012274 3300049580 Bacteria 7301
176 Ga0501046_0417477 3300049580 Bacteria 967
177 Ga0501047_0025149 3300049581 Bacteria 5720
178 Ga0501047_0249280 3300049581 Bacteria 1624
179 Ga0501048_0123857 3300049582 Bacteria 1827
180 Ga0501070_0225390 3300049586 Bacteria 1536
181 Ga0501198_007308 3300049649 Bacteria 1587
182 Ga0501227_065904 3300049665 Bacteria 935
183 Ga0501080_0203684 3300049742 Bacteria 1816
184 Ga0501083_0120815 3300049744 Bacteria 1718
185 Ga0501263_014511 3300049760 Bacteria 1009
186 Ga0501035_0071959 3300049822 Bacteria 3060
187 Ga0501035_0603047 3300049822 Bacteria 894
188 Ga0501035_0896185 3300049822 Bacteria 703
189 Ga0501044_0221267 3300049823 Bacteria 1843
190 Ga0068868_100214362
191 rootL2_10192772
192 rootH1_10194539
193 Ga0070683_100005068
194 Ga0068869_100000006
195 Ga0068868_100230921
196 Ga0070713_100235930
197 Ga0068867_100001137
198 Ga0070686_100695666
199 Ga0070664_101466427
200 Ga0068856_100121856
201 Ga0068859_101182656
202 Ga0070717_10000023
203 Ga0070717_10434879
204 Ga0097621_100004751
205 Ga0068871_100010087
206 Ga0068865_100006518
207 Ga0097620_101182685
208 Ga0105240_10886000
209 Ga0111539_12714037
210 Ga0105243_10127302
211 Ga0157378_11114710
212 Ga0163163_10126446
213 Ga0163163_11188626
214 Ga0157376_11517470
215 Ga0207662_10210083
216 Ga0207700_10198834
217 Ga0207704_10016817
218 Ga0207691_11117441
219 Ga0207689_10000034
220 Ga0207661_10170123
221 Ga0207679_11089197
222 Ga0207677_10015593
223 Ga0207677_10152879
224 Ga0207677_10240414
225 Ga0207648_10047377
226 Ga0207674_12027923
227 Ga0265337_1001207
228 Ga0265337_1010436
229 Ga0265337_1024543
230 Ga0265337_1032564
231 Ga0265319_1002208
232 Ga0265319_1005892
233 Ga0265319_1028170
234 Ga0265319_1078798
235 Ga0265319_1123198
236 Ga0265334_10009440
237 Ga0265334_10019052
238 Ga0265334_10088595
239 Ga0265334_10298974
240 Ga0265318_10000422
241 Ga0265318_10003010
242 Ga0265323_10000032
243 Ga0265323_10001410
244 Ga0265323_10004295
245 Ga0265323_10004441
246 Ga0265323_10007823
247 Ga0265323_10015442
248 Ga0265323_10042289
249 Ga0265323_10044894
250 Ga0265323_10095071
251 Ga0265322_10000889
252 Ga0265322_10048066
253 Ga0265336_10005034
254 Ga0265338_10000919
255 Ga0265338_10045130
256 Ga0265338_10372389
257 Ga0265338_10610383
258 Ga0265338_10691264
259 Ga0265324_10000442
260 Ga0265324_10007087
261 Ga0265324_10032842
262 Ga0265330_10061998
263 Ga0265330_10078400
264 Ga0265330_10283270
265 Ga0265332_10012870
266 Ga0265332_10132734
267 Ga0265328_10011886
268 Ga0265328_10085885
269 Ga0265320_10000430
270 Ga0265320_10004400
271 Ga0265320_10015553
272 Ga0265320_10029684
273 Ga0265320_10049523
274 Ga0265320_10113036
275 Ga0265320_10146461
276 Ga0265325_10028951
277 Ga0265329_10050744
278 Ga0265329_10101094
279 Ga0265329_10235527
280 Ga0265340_10023645
281 Ga0265340_10390209
282 Ga0265339_10014231
283 Ga0265339_10108018
284 Ga0265339_10288409
285 Ga0265331_10235231
286 Ga0265331_10432052
287 Ga0265327_10020356
288 Ga0265327_10041586
289 Ga0265316_10006352
290 Ga0265316_10014232
291 Ga0265316_10018641
292 Ga0265316_10022322
293 Ga0265316_10024767
294 Ga0265316_10035011
295 Ga0265316_10083805
296 Ga0265316_10120295
297 Ga0265316_10305498
298 Ga0265316_10658933
299 Ga0265316_10797502
300 Ga0307509_10401986
301 Ga0307408_100000009
302 Ga0265313_10000484
303 Ga0265313_10001463
304 Ga0265313_10003264
305 Ga0265313_10004532
306 Ga0265313_10011828
307 Ga0265314_10002903
308 Ga0265314_10027382
309 Ga0265314_10078015
310 Ga0265314_10462731
311 Ga0265314_10648493
312 Ga0265314_10688625
313 Ga0265342_10003050
314 Ga0265342_10025901
315 Ga0265342_10027804
316 Ga0265342_10067950
317 Ga0265342_10094647
318 Ga0265342_10364269
319 Ga0265342_10365174
320 Ga0307413_10144926
321 Ga0307413_10227256
322 Ga0307410_10000159
323 Ga0307409_100000062
324 Ga0307409_101820641
325 Ga0307416_100000018
326 Ga0307416_100346161
327 Ga0307414_10097258
328 Ga0373939_0250198
329 Ga0373935_0198991
330 Ga0373933_0146389
331 Ga0395905_0000064
332 Ga0395905_0286649
333 Ga0439443_018528
334 Ga0451577_0002218
335 Ga0451577_0033618
336 Ga0451577_0143666
337 Ga0451577_1074577
338 Ga0453683_0000626
339 Ga0453683_0216138
340 Ga0453683_0241554
341 Ga0453684_0001461
342 Ga0453684_0036594
343 Ga0453684_0118813
344 Ga0453684_0484702
345 Ga0453684_1337939
346 Ga0453684_1339531
347 Ga0451576_0000269
348 Ga0451576_0000396
349 Ga0451576_0014056
350 Ga0451576_0067253
351 Ga0451576_0800906
352 Ga0495636_0089605
353 Ga0501031_0019745
354 Ga0501032_0001667
355 Ga0501033_0049355
356 Ga0501034_0062976
357 Ga0501036_0002704
358 Ga0501038_0016933
359 Ga0501039_0139340
360 Ga0501042_0032053
361 Ga0501043_0283106
362 Ga0501043_0355424
363 Ga0501043_0420713
364 Ga0501046_0012274
365 Ga0501046_0417477
366 Ga0501047_0025149
367 Ga0501047_0249280
368 Ga0501048_0123857
369 Ga0501070_0225390
370 Ga0501198_007308
371 Ga0501227_065904
372 Ga0501080_0203684
373 Ga0501083_0120815
374 Ga0501263_014511
375 Ga0501035_0071959
376 Ga0501035_0603047
377 Ga0501035_0896185
378 Ga0501044_0221267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

2

103

0.98

PF01230

HIT

HIT domain

10

103

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9804 3 113
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.9795 20 113
5waa-assembly1.cif.gz_B human histidine triad nucleotide binding protein 1 (hhint1) c84r mutant 0.9773 2 113
6j65-assembly1.cif.gz_B crystal structure of human hint1 mutant complexing with ap4a ii 0.9761 2 113
1kpc-assembly1.cif.gz_B pkci-1-apo+zinc 0.9758 3 113
ID Description Score Start End Superfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9758 3 113 3.30.428.10
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9717 2 113 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9683 1 113 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9672 3 113 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9615 15 113 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2G4GF74-F1-model_v4 Histidine triad nucleotide-binding protein 0.9951 2 113 GO:0003824
AF-B1ZNA1-F1-model_v4 Histidine triad (HIT) protein 0.9926 1 113 GO:0003824
AF-A0A2D8I0C8-F1-model_v4 Histidine triad nucleotide-binding protein 0.9919 2 113 GO:0003824
AF-A0A1G3Z4C0-F1-model_v4 Histidine triad nucleotide-binding protein 0.9913 1 113 GO:0003824
AF-A0A368B838-F1-model_v4 Histidine triad nucleotide-binding protein 0.99 2 113 GO:0003824

Map