F290302

General Info

Members Datasets Scaffolds Average Seq Length
189 128 178 302

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10005194|Ga0055531_100051948
Length 325
Sequence MPTRARGSKRRSPMAEPIALTALALDAAFGWPRVLYRRVGHPVGLFALIIEGCEARWNRPEHGFAVRRALGVLTLLILXXLVAGSGWALQRLLILSFGAWGWIGIAVLAWPALAQRSLFDHVRVVGERLDAGDLAGAQNAVGMIVGRDTVVLDEAGVARAAIESLAESFCDGVAAPLFWLLLLGLPGVWAYKAVNTADSLIGHREDRWRAFGWAAARTDDLANWIPARLSGLLLCLAGGGGWRVLRRDAHNHASPNAGWPEAAMAGALGLRLAGPIAYDGVMHDKSWIGDGASDAGGDEIDRALAIYLRACLFLWLIAGVVAWAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
11 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
12 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
112 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
125 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 0
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.86
Nodule 0.53
Rhizoplane 6.35
Rhizosphere 44.97
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_870760 2162886007 Bacteria 3071
2 JGI24752J21851_1001910 3300001976 Bacteria 2779
3 JGI24034J26672_10013536 3300002239 Bacteria 1238
4 JGI25150J39212_1000451 3300002774 Bacteria 18181
5 JGI25151J46595_10004394 3300003187 Bacteria 7471
6 JGI25153J46596_10000028 3300003215 Bacteria 209842
7 rootH2_10082854 3300003320 Bacteria 1409
8 Ga0055536_1002023 3300003781 Bacteria 11621
9 Ga0055536_1002122 3300003781 Bacteria 11290
10 Ga0055530_10000156 3300003791 Bacteria 61575
11 Ga0055530_10000275 3300003791 Bacteria 46696
12 Ga0055540_1004364 3300003792 Bacteria 6414
13 Ga0055531_10000420 3300003794 Bacteria 40245
14 Ga0055531_10005194 3300003794 Bacteria 7661
15 Ga0065165_1003359 3300005262 Bacteria 11369
16 Ga0065704_10070440 3300005289 Bacteria 24705
17 Ga0070670_100000014 3300005331 Bacteria 234648
18 Ga0070669_100000227 3300005353 Bacteria 46918
19 Ga0070669_100067032 3300005353 Bacteria 2647
20 Ga0070667_100000912 3300005367 Bacteria 27324
21 Ga0070667_100002842 3300005367 Bacteria 14943
22 Ga0070667_100047757 3300005367 Bacteria 3602
23 Ga0070665_100003490 3300005548 Bacteria 16739
24 Ga0068859_100376045 3300005617 Bacteria 1516
25 Ga0068864_100000021 3300005618 Bacteria 262378
26 Ga0068863_100000009 3300005841 Bacteria 250538
27 Ga0068860_100012059 3300005843 Bacteria 8513
28 Ga0068862_100000017 3300005844 Bacteria 247616
29 Ga0068862_100002799 3300005844 Bacteria 15279
30 Ga0068862_100062079 3300005844 Bacteria 3213
31 Ga0075368_10000980 3300006042 Bacteria 8913
32 Ga0075363_100024098 3300006048 Bacteria 3091
33 Ga0075364_10092088 3300006051 Bacteria 2012
34 Ga0075367_10004317 3300006178 Bacteria 6915
35 Ga0075367_10007577 3300006178 Bacteria 5570
36 Ga0097620_100376025 3300006931 Bacteria 1516
37 Ga0105251_10000079 3300009011 Bacteria 92478
38 Ga0105248_10044282 3300009177 Bacteria 4992
39 Ga0105248_10257652 3300009177 Bacteria 1964
40 Ga0105249_10000886 3300009553 Bacteria 26530
41 Ga0105249_10006741 3300009553 Bacteria 10006
42 Ga0163162_10061056 3300013306 Bacteria 3807
43 Ga0157379_10096599 3300014968 Bacteria 2652
44 Ga0163161_10010343 3300017792 Bacteria 6460
45 Ga0163161_10133793 3300017792 Bacteria 1872
46 Ga0163161_10146011 3300017792 Bacteria 1794
47 Ga0207425_1000005 3300025245 Bacteria 900502
48 Ga0209129_1000228 3300025258 Bacteria 63465
49 Ga0209565_1000180 3300025263 Bacteria 78672
50 Ga0209565_1005396 3300025263 Bacteria 3723
51 Ga0209675_1000287 3300025291 Bacteria 47834
52 Ga0209676_1000146 3300025292 Bacteria 174095
53 Ga0209676_1000672 3300025292 Bacteria 48630
54 Ga0209676_1001657 3300025292 Bacteria 19438
55 Ga0209676_1004465 3300025292 Bacteria 7781
56 Ga0209676_1012526 3300025292 Bacteria 3324
57 Ga0209025_1000296 3300025294 Bacteria 111440
58 Ga0209564_1010604 3300025295 Bacteria 4221
59 Ga0209758_1000002 3300025297 Bacteria 1400310
60 Ga0209758_1033967 3300025297 Bacteria 2038
61 Ga0209050_1000001 3300025298 Bacteria 3563507
62 Ga0209050_1000423 3300025298 Bacteria 78194
63 Ga0209050_1006930 3300025298 Bacteria 6537
64 Ga0209050_1009185 3300025298 Bacteria 5108
65 Ga0209050_1013939 3300025298 Bacteria 3518
66 Ga0209051_1000193 3300025303 Bacteria 108391
67 Ga0209257_1000267 3300025304 Bacteria 119949
68 Ga0209257_1000277 3300025304 Bacteria 114825
69 Ga0209257_1000874 3300025304 Bacteria 42712
70 Ga0209257_1000917 3300025304 Bacteria 41014
71 Ga0207713_1001423 3300025735 Bacteria 19174
72 Ga0207713_1012185 3300025735 Bacteria 4621
73 Ga0207681_10000241 3300025923 Bacteria 41914
74 Ga0207650_10000095 3300025925 Bacteria 116052
75 Ga0207644_10047942 3300025931 Bacteria 3051
76 Ga0207711_10073864 3300025941 Bacteria 2965
77 Ga0207712_10000536 3300025961 Bacteria 30969
78 Ga0207712_10005441 3300025961 Bacteria 8036
79 Ga0207668_10068325 3300025972 Bacteria 2526
80 Ga0207658_10000775 3300025986 Bacteria 27323
81 Ga0207658_10001779 3300025986 Bacteria 16124
82 Ga0207658_10047581 3300025986 Bacteria 3140
83 Ga0207641_10000017 3300026088 Bacteria 299119
84 Ga0207641_10005455 3300026088 Bacteria 10849
85 Ga0207676_10000037 3300026095 Bacteria 180826
86 Ga0209281_1015955 3300027111 Bacteria 1555
87 Ga0209813_10000061 3300027866 Bacteria 43981
88 Ga0209813_10000243 3300027866 Bacteria 16043
89 Ga0268266_10004396 3300028379 Bacteria 13507
90 Ga0268265_10000025 3300028380 Bacteria 250207
91 Ga0268265_10083438 3300028380 Bacteria 2530
92 Ga0268265_10083656 3300028380 Bacteria 2527
93 Ga0268264_10022860 3300028381 Bacteria 5101
94 Ga0307513_10395813 3300031456 Bacteria 1117
95 Ga0307412_10001382 3300031911 Bacteria 13475
96 Ga0307412_10005429 3300031911 Bacteria 7154
97 Ga0307412_10043975 3300031911 Bacteria 2912
98 Ga0307412_10384917 3300031911 Bacteria 1137
99 Ga0307414_10000112 3300032004 Bacteria 57809
100 Ga0307414_10025864 3300032004 Bacteria 3767
101 Ga0307414_10028755 3300032004 Bacteria 3609
102 Ga0307414_10109181 3300032004 Bacteria 2101
103 Ga0451793_0178337 3300041452 Bacteria 1757
104 Ga0451807_2172452 3300041486 Bacteria 1126
105 Ga0451837_1074781 3300041494 Bacteria 1670
106 Ga0495616_0000015 3300046513 Bacteria 187751
107 Ga0495632_0068166 3300046519 Bacteria 1715
108 Ga0495643_0046214 3300046522 Bacteria 2361
109 Ga0495668_0000015 3300046616 Bacteria 441932
110 Ga0495668_0003455 3300046616 Bacteria 11818
111 Ga0495625_0000190 3300046660 Bacteria 97529
112 Ga0495686_0005402 3300047472 Bacteria 10090
113 Ga0495686_0017474 3300047472 Bacteria 4832
114 Ga0495686_0019179 3300047472 Bacteria 4573
115 Ga0496101_0110182 3300048904 Bacteria 2071
116 Ga0496102_0001842 3300048905 Bacteria 18304
117 Ga0496102_0005902 3300048905 Bacteria 10427
118 Ga0496103_0000489 3300048906 Bacteria 32960
119 Ga0496104_0008218 3300048907 Bacteria 9265
120 Ga0496105_0006390 3300048908 Bacteria 9058
121 Ga0496112_0068024 3300048915 Bacteria 3517
122 Ga0496113_0217415 3300048916 Bacteria 1522
123 Ga0496115_0511140 3300048918 Bacteria 964
124 Ga0496117_0001446 3300048920 Bacteria 34224
125 Ga0496117_0003670 3300048920 Bacteria 17647
126 Ga0496117_0015461 3300048920 Bacteria 6505
127 Ga0496118_0000216 3300048921 Bacteria 100502
128 Ga0496118_0001612 3300048921 Bacteria 33376
129 Ga0496118_0049515 3300048921 Bacteria 3234
130 Ga0496119_0000315 3300048922 Bacteria 67712
131 Ga0496119_0020519 3300048922 Bacteria 4819
132 Ga0496120_0012439 3300048923 Bacteria 5794
133 Ga0496121_0015721 3300048924 Bacteria 7890
134 Ga0496122_0020840 3300048925 Bacteria 5898
135 Ga0496123_0062341 3300048926 Bacteria 2389
136 Ga0496124_0190107 3300048927 Bacteria 1572
137 Ga0496125_0037764 3300048928 Bacteria 4194
138 Ga0496126_0005518 3300048929 Bacteria 14404
139 Ga0496126_0152034 3300048929 Bacteria 1983
140 Ga0496126_0194887 3300048929 Bacteria 1714
141 Ga0501032_0003515 3300049569 Bacteria 11970
142 Ga0501033_0002144 3300049570 Bacteria 17070
143 Ga0501034_0014007 3300049571 Bacteria 8255
144 Ga0501036_0003745 3300049572 Bacteria 12185
145 Ga0501036_0083092 3300049572 Bacteria 2707
146 Ga0501037_0199218 3300049573 Bacteria 1415
147 Ga0501038_0006472 3300049574 Bacteria 10844
148 Ga0501039_0016452 3300049575 Bacteria 5666
149 Ga0501043_0253324 3300049579 Bacteria 1355
150 Ga0501047_0036195 3300049581 Bacteria 4769
151 Ga0501048_0128903 3300049582 Bacteria 1789
152 Ga0501249_000496 3300049679 Bacteria 9691
153 Ga0501225_0000225 3300049705 Bacteria 17881
154 Ga0501035_0003659 3300049822 Bacteria 14662
155 Ga0501044_0000171 3300049823 Bacteria 80218
156 Ga0501044_0000995 3300049823 Bacteria 34093
157 nmdc:mga03683_21199_c1 3300050489 Bacteria 2502
158 nmdc:mga03n38_1570_c1 3300050490 Bacteria 6632
159 nmdc:mga03n38_6224_c1 3300050490 Bacteria 4129
160 nmdc:mga00v17_13714_c1 3300050491 Bacteria 4505
161 nmdc:mga00v17_57189_c1 3300050491 Bacteria 2386
162 nmdc:mga06z11_349_c1 3300050494 Bacteria 17408
163 nmdc:mga06z11_78_c1 3300050494 Bacteria 40825
164 nmdc:mga04h51_41_c1 3300050495 Bacteria 43980
165 nmdc:mga04h51_575_c1 3300050495 Bacteria 8767
166 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
167 nmdc:mga0sz30_17822_c1 3300050516 Bacteria 2836
168 Ga0500643_000822 3300053087 Bacteria 20046
169 Ga0500643_003246 3300053087 Bacteria 7919
170 Ga0500643_020666 3300053087 Bacteria 2147
171 Ga0500641_0102289 3300053096 Unclassified 1229
172 Ga0500592_000068 3300053116 Bacteria 27176
173 Ga0500607_000021 3300053121 Bacteria 99974
174 Ga0500559_0000335 3300053136 Bacteria 35252
175 Ga0500559_0013826 3300053136 Bacteria 3413
176 Ga0500604_0001596 3300053151 Bacteria 6367
177 Ga0500627_0000008 3300053158 Bacteria 161914
178 Ga0500627_0000940 3300053158 Bacteria 7856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0511140 Ga0496115_0511140_57_905 263
2 3300049679 Ga0501249_000496 Ga0501249_000496_6888_7826 264
3 3300001976 JGI24752J21851_1001910 JGI24752J21851_10019102 266
4 3300005331 Ga0070670_100000014 Ga0070670_100000014197 266
5 3300005367 Ga0070667_100000912 Ga0070667_10000091227 266
6 3300005618 Ga0068864_100000021 Ga0068864_100000021208 266
7 3300005841 Ga0068863_100000009 Ga0068863_100000009215 266
8 3300005844 Ga0068862_100000017 Ga0068862_100000017211 266
9 3300009011 Ga0105251_10000079 Ga0105251_1000007928 266
10 3300009553 Ga0105249_10000886 Ga0105249_1000088623 266
11 3300014968 Ga0157379_10096599 Ga0157379_100965993 266
12 3300025735 Ga0207713_1001423 Ga0207713_100142314 266
13 3300025925 Ga0207650_10000095 Ga0207650_1000009525 266
14 3300025961 Ga0207712_10000536 Ga0207712_100005367 266
15 3300025986 Ga0207658_10000775 Ga0207658_1000077527 266
16 3300026088 Ga0207641_10000017 Ga0207641_10000017235 266
17 3300026095 Ga0207676_10000037 Ga0207676_1000003751 266
18 3300028380 Ga0268265_10000025 Ga0268265_1000002528 266
19 3300048920 Ga0496117_0001446 Ga0496117_0001446_26375_27313 266
20 3300048921 Ga0496118_0000216 Ga0496118_0000216_24818_25756 266
21 3300027111 Ga0209281_1015955 Ga0209281_10159552 268
22 3300003781 Ga0055536_1002023 Ga0055536_10020237 270
23 3300003791 Ga0055530_10000156 Ga0055530_1000015640 270
24 3300003791 Ga0055530_10000275 Ga0055530_100002759 270
25 3300003794 Ga0055531_10000420 Ga0055531_1000042022 270
26 3300025292 Ga0209676_1000672 Ga0209676_100067210 270
27 3300025298 Ga0209050_1000423 Ga0209050_100042339 270
28 3300025304 Ga0209257_1000267 Ga0209257_100026738 270
29 3300053116 Ga0500592_000068 Ga0500592_000068_13764_14702 270
30 3300025263 Ga0209565_1000180 Ga0209565_100018052 271
31 3300025295 Ga0209564_1010604 Ga0209564_10106042 271
32 3300049705 Ga0501225_0000225 Ga0501225_0000225_3418_4347 271
33 3300049582 Ga0501048_0128903 Ga0501048_0128903_482_1408 272
34 3300003781 Ga0055536_1002122 Ga0055536_10021223 273
35 3300025292 Ga0209676_1000146 Ga0209676_100014655 273
36 3300005367 Ga0070667_100047757 Ga0070667_1000477572 274
37 3300017792 Ga0163161_10133793 Ga0163161_101337932 274
38 3300025986 Ga0207658_10047581 Ga0207658_100475813 274
39 3300002774 JGI25150J39212_1000451 JGI25150J39212_10004519 275
40 3300003187 JGI25151J46595_10004394 JGI25151J46595_100043948 275
41 3300003215 JGI25153J46596_10000028 JGI25153J46596_10000028198 275
42 3300003792 Ga0055540_1004364 Ga0055540_10043644 275
43 3300025245 Ga0207425_1000005 Ga0207425_1000005193 275
44 3300025258 Ga0209129_1000228 Ga0209129_100022823 275
45 3300025263 Ga0209565_1005396 Ga0209565_10053962 275
46 3300025292 Ga0209676_1004465 Ga0209676_10044656 275
47 3300025292 Ga0209676_1012526 Ga0209676_10125262 275
48 3300025294 Ga0209025_1000296 Ga0209025_100029696 275
49 3300025297 Ga0209758_1000002 Ga0209758_10000021151 275
50 3300025298 Ga0209050_1000001 Ga0209050_10000011139 275
51 3300025298 Ga0209050_1009185 Ga0209050_10091854 275
52 3300025303 Ga0209051_1000193 Ga0209051_100019314 275
53 3300025304 Ga0209257_1000874 Ga0209257_10008744 275
54 3300025304 Ga0209257_1000917 Ga0209257_10009174 275
55 3300006178 Ga0075367_10004317 Ga0075367_100043176 276
56 3300027866 Ga0209813_10000061 Ga0209813_1000006134 276
57 3300048920 Ga0496117_0015461 Ga0496117_0015461_3948_4925 276
58 3300048921 Ga0496118_0001612 Ga0496118_0001612_28198_29175 276
59 3300048927 Ga0496124_0190107 Ga0496124_0190107_536_1513 276
60 3300050490 nmdc:mga03n38_1570_c1 nmdc:mga03n38_1570_c1_4345_5298 276
61 3300050494 nmdc:mga06z11_78_c1 nmdc:mga06z11_78_c1_12013_12966 276
62 3300050495 nmdc:mga04h51_41_c1 nmdc:mga04h51_41_c1_12107_13060 276
63 3300047472 Ga0495686_0019179 Ga0495686_0019179_377_1351 277
64 3300031456 Ga0307513_10395813 Ga0307513_103958131 278
65 3300049572 Ga0501036_0083092 Ga0501036_0083092_1024_1962 278
66 3300049823 Ga0501044_0000171 Ga0501044_0000171_36689_37627 278
67 3300017792 Ga0163161_10010343 Ga0163161_100103432 279
68 3300017792 Ga0163161_10146011 Ga0163161_101460112 279
69 3300031911 Ga0307412_10005429 Ga0307412_100054292 279
70 3300049569 Ga0501032_0003515 Ga0501032_0003515_8045_8995 280
71 3300049570 Ga0501033_0002144 Ga0501033_0002144_2049_2999 280
72 3300049571 Ga0501034_0014007 Ga0501034_0014007_2404_3354 280
73 3300049572 Ga0501036_0003745 Ga0501036_0003745_8415_9365 280
74 3300049573 Ga0501037_0199218 Ga0501037_0199218_342_1292 280
75 3300049574 Ga0501038_0006472 Ga0501038_0006472_7809_8759 280
76 3300049575 Ga0501039_0016452 Ga0501039_0016452_1997_2947 280
77 3300049579 Ga0501043_0253324 Ga0501043_0253324_240_1190 280
78 3300049581 Ga0501047_0036195 Ga0501047_0036195_1640_2590 280
79 3300049822 Ga0501035_0003659 Ga0501035_0003659_195_1145 280
80 3300049823 Ga0501044_0000995 Ga0501044_0000995_17129_18079 280
81 3300005844 Ga0068862_100002799 Ga0068862_10000279911 281
82 3300028380 Ga0268265_10083438 Ga0268265_100834382 281
83 3300031911 Ga0307412_10043975 Ga0307412_100439752 281
84 3300032004 Ga0307414_10025864 Ga0307414_100258642 281
85 3300046522 Ga0495643_0046214 Ga0495643_0046214_1108_2046 281
86 3300048924 Ga0496121_0015721 Ga0496121_0015721_6452_7390 282
87 3300003320 rootH2_10082854 rootH2_100828542 283
88 3300046519 Ga0495632_0068166 Ga0495632_0068166_421_1335 284
89 3300053096 Ga0500641_0102289 Ga0500641_0102289_83_997 284
90 3300005353 Ga0070669_100067032 Ga0070669_1000670322 285
91 3300032004 Ga0307414_10028755 Ga0307414_100287554 285
92 3300053158 Ga0500627_0000940 Ga0500627_0000940_6512_7447 285
93 iso_pu_bacteria 2599185354 2600200612 287
94 iso_pu_bacteria 2643221563 2643834666 287
95 iso_pu_bacteria 2643221608 2644055593 287
96 iso_pu_bacteria 2751185897 2753763608 287
97 iso_pu_bacteria 2852653556 2852656130 287
98 3300009177 Ga0105248_10044282 Ga0105248_100442824 288
99 iso_pu_bacteria 2643221541 2643731696 288
100 iso_pu_bacteria 2643221606 2644041977 288
101 iso_pu_bacteria 2643221671 2644394380 288
102 iso_pu_bacteria 2852680915 2852683294 288
103 iso_pu_bacteria 2885429604 2885431784 288
104 iso_pu_bacteria 2919709256 2919712076 288
105 3300048929 Ga0496126_0194887 Ga0496126_0194887_244_1191 290
106 3300041486 Ga0451807_2172452 Ga0451807_2172452_89_1024 291
107 3300046513 Ga0495616_0000015 Ga0495616_0000015_23024_23959 291
108 3300048922 Ga0496119_0000315 Ga0496119_0000315_64128_65198 291
109 3300005262 Ga0065165_1003359 Ga0065165_10033595 292
110 3300006042 Ga0075368_10000980 Ga0075368_100009808 292
111 3300006048 Ga0075363_100024098 Ga0075363_1000240982 292
112 3300006051 Ga0075364_10092088 Ga0075364_100920882 292
113 3300006178 Ga0075367_10007577 Ga0075367_100075773 292
114 3300025291 Ga0209675_1000287 Ga0209675_10002878 292
115 3300025292 Ga0209676_1001657 Ga0209676_100165710 292
116 3300025297 Ga0209758_1033967 Ga0209758_10339672 292
117 3300025298 Ga0209050_1006930 Ga0209050_10069307 292
118 3300025298 Ga0209050_1013939 Ga0209050_10139394 292
119 3300025304 Ga0209257_1000277 Ga0209257_100027752 292
120 3300027866 Ga0209813_10000243 Ga0209813_1000024310 292
121 3300031911 Ga0307412_10001382 Ga0307412_100013827 292
122 3300031911 Ga0307412_10384917 Ga0307412_103849171 292
123 3300032004 Ga0307414_10109181 Ga0307414_101091812 292
124 3300041452 Ga0451793_0178337 Ga0451793_0178337_554_1492 292
125 3300041494 Ga0451837_1074781 Ga0451837_1074781_19_966 292
126 3300046616 Ga0495668_0000015 Ga0495668_0000015_224091_225029 292
127 3300046616 Ga0495668_0003455 Ga0495668_0003455_8278_9216 292
128 3300047472 Ga0495686_0005402 Ga0495686_0005402_2307_3245 292
129 3300047472 Ga0495686_0017474 Ga0495686_0017474_134_1072 292
130 3300048904 Ga0496101_0110182 Ga0496101_0110182_635_1570 292
131 3300048905 Ga0496102_0001842 Ga0496102_0001842_1539_2474 292
132 3300048905 Ga0496102_0005902 Ga0496102_0005902_5794_6915 292
133 3300048906 Ga0496103_0000489 Ga0496103_0000489_17709_18644 292
134 3300048907 Ga0496104_0008218 Ga0496104_0008218_114_1049 292
135 3300048908 Ga0496105_0006390 Ga0496105_0006390_2782_3717 292
136 3300048915 Ga0496112_0068024 Ga0496112_0068024_915_1850 292
137 3300048916 Ga0496113_0217415 Ga0496113_0217415_165_1100 292
138 3300048920 Ga0496117_0003670 Ga0496117_0003670_5487_6422 292
139 3300048921 Ga0496118_0049515 Ga0496118_0049515_1792_2727 292
140 3300048922 Ga0496119_0020519 Ga0496119_0020519_1103_2038 292
141 3300048923 Ga0496120_0012439 Ga0496120_0012439_3900_4835 292
142 3300048925 Ga0496122_0020840 Ga0496122_0020840_779_1714 292
143 3300048926 Ga0496123_0062341 Ga0496123_0062341_511_1446 292
144 3300048928 Ga0496125_0037764 Ga0496125_0037764_511_1446 292
145 3300048929 Ga0496126_0005518 Ga0496126_0005518_8961_9896 292
146 3300048929 Ga0496126_0152034 Ga0496126_0152034_921_1859 292
147 3300050489 nmdc:mga03683_21199_c1 nmdc:mga03683_21199_c1_1309_2247 292
148 3300050490 nmdc:mga03n38_6224_c1 nmdc:mga03n38_6224_c1_3115_4053 292
149 3300050491 nmdc:mga00v17_13714_c1 nmdc:mga00v17_13714_c1_1280_2218 292
150 3300050491 nmdc:mga00v17_57189_c1 nmdc:mga00v17_57189_c1_169_1107 292
151 3300050494 nmdc:mga06z11_349_c1 nmdc:mga06z11_349_c1_5963_6901 292
152 3300050495 nmdc:mga04h51_575_c1 nmdc:mga04h51_575_c1_5962_6900 292
153 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_3947_4885 292
154 3300050516 nmdc:mga0sz30_17822_c1 nmdc:mga0sz30_17822_c1_1436_2374 292
155 3300053087 Ga0500643_000822 Ga0500643_000822_9349_10287 292
156 3300053087 Ga0500643_003246 Ga0500643_003246_5996_6934 292
157 3300053087 Ga0500643_020666 Ga0500643_020666_484_1422 292
158 3300053121 Ga0500607_000021 Ga0500607_000021_64122_65060 292
159 3300053136 Ga0500559_0000335 Ga0500559_0000335_12522_13460 292
160 3300053151 Ga0500604_0001596 Ga0500604_0001596_2293_3231 292
161 3300053158 Ga0500627_0000008 Ga0500627_0000008_45574_46512 292
162 3300032004 Ga0307414_10000112 Ga0307414_1000011230 298
163 2162886007 SwRhRL2b_contig_870760 SwRhRL2b_0510.00000540 301
164 3300002239 JGI24034J26672_10013536 JGI24034J26672_100135362 301
165 3300003794 Ga0055531_10005194 Ga0055531_100051948 301
166 3300005289 Ga0065704_10070440 Ga0065704_1007044024 301
167 3300005353 Ga0070669_100000227 Ga0070669_10000022741 301
168 3300005367 Ga0070667_100002842 Ga0070667_1000028429 301
169 3300005548 Ga0070665_100003490 Ga0070665_10000349012 301
170 3300005617 Ga0068859_100376045 Ga0068859_1003760452 301
171 3300005843 Ga0068860_100012059 Ga0068860_1000120598 301
172 3300005844 Ga0068862_100062079 Ga0068862_1000620793 301
173 3300006931 Ga0097620_100376025 Ga0097620_1003760252 301
174 3300009177 Ga0105248_10257652 Ga0105248_102576522 301
175 3300009553 Ga0105249_10006741 Ga0105249_100067416 301
176 3300013306 Ga0163162_10061056 Ga0163162_100610562 301
177 3300025735 Ga0207713_1012185 Ga0207713_10121852 301
178 3300025923 Ga0207681_10000241 Ga0207681_100002416 301
179 3300025931 Ga0207644_10047942 Ga0207644_100479422 301
180 3300025941 Ga0207711_10073864 Ga0207711_100738642 301
181 3300025961 Ga0207712_10005441 Ga0207712_100054416 301
182 3300025972 Ga0207668_10068325 Ga0207668_100683252 301
183 3300025986 Ga0207658_10001779 Ga0207658_1000177914 301
184 3300026088 Ga0207641_10005455 Ga0207641_100054555 301
185 3300028379 Ga0268266_10004396 Ga0268266_100043966 301
186 3300028380 Ga0268265_10083656 Ga0268265_100836562 301
187 3300028381 Ga0268264_10022860 Ga0268264_100228603 301
188 3300046660 Ga0495625_0000190 Ga0495625_0000190_56657_57634 301
189 3300053136 Ga0500559_0013826 Ga0500559_0013826_600_1574 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03186

CobD_Cbib

CobD/Cbib protein

19

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l2b-assembly1.cif.gz_A structure of cntnw n149s, e332a in an outward-facing state 0.2831 8 245
5l2b-assembly1.cif.gz_B structure of cntnw n149s, e332a in an outward-facing state 0.2817 8 245
5l2a-assembly1.cif.gz_A structure of cntnw n149s,f366a in an outward-facing state 0.2756 3 245
6gn8-assembly1.cif.gz_B exoenzyme s from pseudomonas aeruginosa in complex with human 14-3-3 protein beta, trimeric crystal form 0.2659 11 201
4pd7-assembly1.cif.gz_A structure of vccnt bound to zebularine 0.2582 8 245
ID Description Score Start End Superfamily
af_Q80TT2_635_867_1.10.357.50 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2; 0.3349 7 204 1.10.357.50
af_P39398_249_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2977 63 245 1.20.1250.20
af_P49770_1_146_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.2844 104 227 1.25.40.90
af_K7K831_27_178_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.279 44 203 1.20.140.40
af_P39398_249_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2732 63 245 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A520HYS6-F1-model_v4 Cobalamin biosynthesis protein 0.9636 201 301 GO:0005886
GO:0009236
GO:0048472
AF-A0A520HG45-F1-model_v4 Cobalamin biosynthesis protein 0.9626 177 301 GO:0005886
GO:0009236
GO:0048472
AF-A0A1E4MKH4-F1-model_v4 Cobalamin biosynthesis protein CobD 0.956 10 301 GO:0005886
GO:0009236
GO:0015420
GO:0048472
AF-W1RV72-F1-model_v4 Adenosylcobinamide-phosphate synthase 0.9558 115 301 GO:0005886
GO:0009236
GO:0048472
AF-A0A1I2QB77-F1-model_v4 Cobalamin biosynthesis protein CobD 0.949 10 301 GO:0005886
GO:0009236
GO:0015420
GO:0048472

Feature Viewer

pLDDT pTM Quality
80.22 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map