F290230

General Info

Members Datasets Scaffolds Average Seq Length
189 131 175 293

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10000770|JGI24740J21852_1000077010
Length 307
Sequence VRIAVTGKVGQVVASLIERAAAAGHEVIALGRPELDLADPVSIGRALNAAAPDAIVSAAAYTAVDRAESESDLAYAVNGRGASAVAEAAEALGVPLVHVSTDYVFDGTLGRPYVETDPTEPTGVYGASKLAGEQAVLAAHGDNSAVLRVAWVYSPFSTNFVKTMLRLAGDRREVSVVADQFGNPTSALNIADGIIRVATNLVADSYPELRGIFHMTASGEASWADFAEAIFAASAARGGPSAQVRRITTADYPTLTTRPANSRLDCGLIARVHGVALPDWRQSLETVITRLHNLQRPADPAERNDDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2643221610 Ensifer sp. Root74 Isolate Unclassified
4 2643221675 Ensifer sp. Root1298 Isolate Unclassified
5 2643221680 Ensifer sp. Root1312 Isolate Unclassified
6 2643221726 Ensifer sp. Root954 Isolate Unclassified
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
9 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
10 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
11 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
12 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
130 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
131 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 0
Isolates 7.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 5.82
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 21.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2038536 2162886007 Bacteria 5256
2 SwRhRL2b_contig_2292987 2162886007 Bacteria 31145
3 SwRhRL2b_contig_688890 2162886007 Bacteria 18649
4 JGI24741J21665_1001553 3300001915 Bacteria 6487
5 JGI24740J21852_10000363 3300001979 Bacteria 19454
6 JGI24740J21852_10000770 3300001979 Bacteria 14043
7 JGI24739J22299_10012119 3300001989 Bacteria 3167
8 JGI24735J21928_10006185 3300002067 Bacteria 3951
9 JGI24748J21848_1000643 3300002074 Bacteria 3745
10 Ga0055524_1001890 3300003775 Bacteria 11377
11 Ga0065704_10000277 3300005289 Bacteria 104842
12 Ga0065704_10001247 3300005289 Bacteria 22290
13 Ga0065704_10070346 3300005289 Bacteria 31193
14 Ga0070668_100002474 3300005347 Bacteria 13590
15 Ga0070669_100000039 3300005353 Bacteria 135033
16 Ga0070671_100004551 3300005355 Bacteria 10981
17 Ga0070667_100000719 3300005367 Bacteria 31865
18 Ga0070663_100035287 3300005455 Bacteria 3469
19 Ga0068853_100000580 3300005539 Bacteria 24987
20 Ga0070665_100001414 3300005548 Bacteria 28192
21 Ga0070665_100163653 3300005548 Bacteria 2227
22 Ga0068857_100313230 3300005577 Bacteria 1448
23 Ga0068857_100381887 3300005577 Bacteria 1308
24 Ga0068854_100001288 3300005578 Bacteria 15095
25 Ga0068854_100323732 3300005578 Bacteria 1254
26 Ga0068856_100004335 3300005614 Bacteria 14150
27 Ga0068851_10006377 3300005834 Bacteria 5382
28 Ga0068863_100037533 3300005841 Bacteria 4613
29 Ga0068860_100004085 3300005843 Bacteria 14982
30 Ga0075432_10000846 3300006058 Bacteria 9620
31 Ga0075370_10036553 3300006353 Bacteria 2759
32 Ga0105240_10060222 3300009093 Bacteria 4734
33 Ga0105240_10170920 3300009093 Bacteria 2575
34 Ga0105247_10013032 3300009101 Bacteria 4985
35 Ga0105242_10534266 3300009176 Bacteria 1121
36 Ga0105238_10050923 3300009551 Bacteria 4168
37 Ga0105238_10092343 3300009551 Bacteria 3015
38 Ga0105249_10000722 3300009553 Bacteria 30079
39 Ga0157371_10000001 3300013102 Bacteria 1162285
40 Ga0157371_10003592 3300013102 Bacteria 13972
41 Ga0157371_10025351 3300013102 Bacteria 4322
42 Ga0157370_10022700 3300013104 Bacteria 6245
43 Ga0157370_10044458 3300013104 Bacteria 4269
44 Ga0157369_10043417 3300013105 Bacteria 4901
45 Ga0157369_10263253 3300013105 Bacteria 1798
46 Ga0157372_10007486 3300013307 Bacteria 11609
47 Ga0182008_10052251 3300014497 Bacteria 2026
48 Ga0163161_10029234 3300017792 Bacteria 3917
49 Ga0209564_1010807 3300025295 Bacteria 4158
50 Ga0209050_1004466 3300025298 Bacteria 9428
51 Ga0209256_1000122 3300025299 Bacteria 166746
52 Ga0207656_10022425 3300025321 Bacteria 2534
53 Ga0207696_1009712 3300025711 Bacteria 3573
54 Ga0207647_10021644 3300025904 Bacteria 4289
55 Ga0207695_10043668 3300025913 Bacteria 4776
56 Ga0207695_10128593 3300025913 Bacteria 2492
57 Ga0207681_10000144 3300025923 Bacteria 59200
58 Ga0207694_10023424 3300025924 Bacteria 4686
59 Ga0207694_10026644 3300025924 Bacteria 4399
60 Ga0207644_10019639 3300025931 Bacteria 4588
61 Ga0207644_10022162 3300025931 Bacteria 4337
62 Ga0207712_10000559 3300025961 Bacteria 30139
63 Ga0207668_10001544 3300025972 Bacteria 13466
64 Ga0207640_10000660 3300025981 Bacteria 20197
65 Ga0207640_10370362 3300025981 Bacteria 1157
66 Ga0207658_10000216 3300025986 Bacteria 60563
67 Ga0207639_10001421 3300026041 Bacteria 16186
68 Ga0207678_10053600 3300026067 Bacteria 3476
69 Ga0207702_10043529 3300026078 Bacteria 3770
70 Ga0207674_10447752 3300026116 Bacteria 1248
71 Ga0207428_10012236 3300027907 Bacteria 7547
72 Ga0268266_10024222 3300028379 Bacteria 5165
73 Ga0268265_10166007 3300028380 Bacteria 1881
74 Ga0268264_10003503 3300028381 Bacteria 13530
75 Ga0307408_100013850 3300031548 Bacteria 5354
76 Ga0307405_10000174 3300031731 Bacteria 23496
77 Ga0307405_10297252 3300031731 Bacteria 1223
78 Ga0307410_10067113 3300031852 Bacteria 2474
79 Ga0307412_10000500 3300031911 Bacteria 23370
80 Ga0307412_10073045 3300031911 Bacteria 2346
81 Ga0307409_100054221 3300031995 Bacteria 3087
82 Ga0307416_100168719 3300032002 Bacteria 2034
83 Ga0395901_0541040 3300038443 Bacteria 1181
84 Ga0450904_000137 3300042139 Bacteria 16248
85 Ga0451577_0080233 3300042876 Bacteria 2909
86 Ga0466966_0047410 3300044684 Bacteria 2740
87 Ga0453684_0008826 3300044712 Bacteria 17873
88 Ga0453684_0051916 3300044712 Bacteria 5368
89 Ga0451576_0002484 3300045051 Bacteria 27384
90 Ga0451576_0035954 3300045051 Bacteria 5253
91 Ga0495627_000432 3300046453 Bacteria 36351
92 Ga0495627_001001 3300046453 Bacteria 19008
93 Ga0495638_0000607 3300046460 Bacteria 40083
94 Ga0495650_0011475 3300046471 Bacteria 4849
95 Ga0495605_0034541 3300046474 Bacteria 2560
96 Ga0495585_0059534 3300046492 Bacteria 2104
97 Ga0495596_0001695 3300046500 Bacteria 12450
98 Ga0495596_0002376 3300046500 Bacteria 10179
99 Ga0495583_0000122 3300046506 Bacteria 132255
100 Ga0495583_0000727 3300046506 Bacteria 41970
101 Ga0495610_0000082 3300046512 Bacteria 113066
102 Ga0495610_0000243 3300046512 Bacteria 57521
103 Ga0495616_0000049 3300046513 Bacteria 108079
104 Ga0495620_0002894 3300046515 Bacteria 9868
105 Ga0495620_0010428 3300046515 Bacteria 4904
106 Ga0495637_0024441 3300046520 Bacteria 2734
107 Ga0495643_0000224 3300046522 Bacteria 86728
108 Ga0495587_0009019 3300046536 Bacteria 6403
109 Ga0495609_0038923 3300046538 Bacteria 2142
110 Ga0495633_0001232 3300046558 Bacteria 20531
111 Ga0495633_0001488 3300046558 Bacteria 18170
112 Ga0495633_0014184 3300046558 Bacteria 4176
113 Ga0495633_0046698 3300046558 Bacteria 2048
114 Ga0495625_0000832 3300046660 Bacteria 42398
115 Ga0495625_0005611 3300046660 Bacteria 11377
116 Ga0495625_0049679 3300046660 Bacteria 3014
117 Ga0495671_0061229 3300046692 Bacteria 1857
118 Ga0495600_0002050 3300046809 Bacteria 11358
119 Ga0495681_0000179 3300047470 Bacteria 53785
120 Ga0495681_0001625 3300047470 Bacteria 16699
121 Ga0495686_0008456 3300047472 Bacteria 7549
122 Ga0495626_0000219 3300048091 Bacteria 67675
123 Ga0495626_0001225 3300048091 Bacteria 21121
124 Ga0496100_0025383 3300048903 Bacteria 3624
125 Ga0496101_0180745 3300048904 Bacteria 1624
126 Ga0496102_0000698 3300048905 Bacteria 33409
127 Ga0496103_0000258 3300048906 Bacteria 50941
128 Ga0496104_0000675 3300048907 Bacteria 29310
129 Ga0496104_0367570 3300048907 Bacteria 1351
130 Ga0496105_0000184 3300048908 Bacteria 41790
131 Ga0496105_0056984 3300048908 Bacteria 3226
132 Ga0496108_0008596 3300048911 Bacteria 8279
133 Ga0496109_0557679 3300048912 Bacteria 1081
134 Ga0496112_0457174 3300048915 Bacteria 1214
135 Ga0496116_0001606 3300048919 Bacteria 24832
136 Ga0496116_0038217 3300048919 Bacteria 3336
137 Ga0496116_0144693 3300048919 Bacteria 1330
138 Ga0496117_0010819 3300048920 Bacteria 8235
139 Ga0496118_0036593 3300048921 Bacteria 3964
140 Ga0496119_0001028 3300048922 Bacteria 35759
141 Ga0496119_0056741 3300048922 Bacteria 2371
142 Ga0496120_0000961 3300048923 Bacteria 39309
143 Ga0496120_0030393 3300048923 Bacteria 3284
144 Ga0496121_0001607 3300048924 Bacteria 37512
145 Ga0496121_0006397 3300048924 Bacteria 14645
146 Ga0496121_0016263 3300048924 Bacteria 7694
147 Ga0496122_0002492 3300048925 Bacteria 26017
148 Ga0496122_0003011 3300048925 Bacteria 22872
149 Ga0496123_0002688 3300048926 Bacteria 21407
150 Ga0496123_0003061 3300048926 Bacteria 19222
151 Ga0496123_0016671 3300048926 Bacteria 5951
152 Ga0496123_0148202 3300048926 Bacteria 1271
153 Ga0496124_0000946 3300048927 Bacteria 46483
154 Ga0496124_0001488 3300048927 Bacteria 34405
155 Ga0496124_0002149 3300048927 Bacteria 26478
156 Ga0496124_0004303 3300048927 Bacteria 16719
157 Ga0496124_0010844 3300048927 Bacteria 9175
158 Ga0496124_0028128 3300048927 Bacteria 5032
159 Ga0496125_0003189 3300048928 Bacteria 20284
160 Ga0496125_0010581 3300048928 Bacteria 9323
161 Ga0496125_0034851 3300048928 Bacteria 4428
162 Ga0496125_0041191 3300048928 Bacteria 3953
163 Ga0496126_0000158 3300048929 Bacteria 156032
164 Ga0496126_0001697 3300048929 Bacteria 32726
165 Ga0496126_0002551 3300048929 Bacteria 24383
166 Ga0501034_0015730 3300049571 Bacteria 7769
167 Ga0501038_0003137 3300049574 Bacteria 15417
168 Ga0501047_0307023 3300049581 Bacteria 1428
169 Ga0501235_008254 3300049669 Bacteria 2272
170 nmdc:mga07m45_111337_c1 3300050496 Bacteria 1577
171 Ga0500624_000117 3300053157 Bacteria 36573
172 Ga0500624_000225 3300053157 Bacteria 20735
173 Ga0500624_000361 3300053157 Bacteria 14695
174 Ga0500636_0000126 3300053177 Bacteria 39974
175 Ga0501082_0231646 3300060353 Bacteria 1607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100163653 Ga0070665_1001636532 270
2 3300046492 Ga0495585_0059534 Ga0495585_0059534_554_1366 270
3 3300005578 Ga0068854_100001288 Ga0068854_1000012885 272
4 3300009093 Ga0105240_10060222 Ga0105240_100602225 272
5 3300009551 Ga0105238_10050923 Ga0105238_100509235 272
6 3300013102 Ga0157371_10003592 Ga0157371_100035929 272
7 3300025904 Ga0207647_10021644 Ga0207647_100216445 272
8 3300025913 Ga0207695_10043668 Ga0207695_100436682 272
9 3300025924 Ga0207694_10023424 Ga0207694_100234246 272
10 3300025981 Ga0207640_10000660 Ga0207640_100006605 272
11 3300031548 Ga0307408_100013850 Ga0307408_1000138502 272
12 3300031731 Ga0307405_10000174 Ga0307405_100001746 272
13 3300031911 Ga0307412_10000500 Ga0307412_1000050018 272
14 3300031995 Ga0307409_100054221 Ga0307409_1000542213 272
15 3300032002 Ga0307416_100168719 Ga0307416_1001687192 272
16 3300006058 Ga0075432_10000846 Ga0075432_100008462 273
17 3300006353 Ga0075370_10036553 Ga0075370_100365533 273
18 3300025298 Ga0209050_1004466 Ga0209050_10044664 273
19 3300027907 Ga0207428_10012236 Ga0207428_100122367 273
20 3300050496 nmdc:mga07m45_111337_c1 nmdc:mga07m45_111337_c1_370_1272 273
21 3300048926 Ga0496123_0016671 Ga0496123_0016671_2816_3706 276
22 3300048927 Ga0496124_0002149 Ga0496124_0002149_15712_16602 276
23 3300048928 Ga0496125_0003189 Ga0496125_0003189_9516_10406 276
24 3300048928 Ga0496125_0010581 Ga0496125_0010581_6402_7304 276
25 3300044712 Ga0453684_0008826 Ga0453684_0008826_1294_2148 283
26 3300045051 Ga0451576_0035954 Ga0451576_0035954_1294_2148 283
27 3300046660 Ga0495625_0000832 Ga0495625_0000832_13307_14191 283
28 3300048924 Ga0496121_0016263 Ga0496121_0016263_3354_4211 283
29 3300053157 Ga0500624_000117 Ga0500624_000117_2195_3082 283
30 iso_pu_bacteria 8054563764 8054565859 285
31 3300005577 Ga0068857_100381887 Ga0068857_1003818872 286
32 3300005834 Ga0068851_10006377 Ga0068851_100063777 286
33 3300025321 Ga0207656_10022425 Ga0207656_100224253 286
34 3300026116 Ga0207674_10447752 Ga0207674_104477521 286
35 3300031852 Ga0307410_10067113 Ga0307410_100671132 286
36 iso_pu_bacteria 2870068957 2870068981 286
37 3300046558 Ga0495633_0001488 Ga0495633_0001488_2823_3710 287
38 3300053157 Ga0500624_000361 Ga0500624_000361_7113_8000 287
39 iso_pu_bacteria 2919497567 2919501243 287
40 3300042876 Ga0451577_0080233 Ga0451577_0080233_115_984 288
41 3300044712 Ga0453684_0051916 Ga0453684_0051916_916_1785 288
42 3300045051 Ga0451576_0002484 Ga0451576_0002484_1023_1892 288
43 3300060353 Ga0501082_0231646 Ga0501082_0231646_193_1074 288
44 iso_pu_bacteria 2857576091 2857577834 289
45 3300046515 Ga0495620_0010428 Ga0495620_0010428_1887_2777 290
46 iso_pu_bacteria 2928959182 2928961275 290
47 3300005578 Ga0068854_100323732 Ga0068854_1003237322 292
48 3300025295 Ga0209564_1010807 Ga0209564_10108072 292
49 3300025981 Ga0207640_10370362 Ga0207640_103703621 292
50 3300048925 Ga0496122_0002492 Ga0496122_0002492_2243_3121 292
51 3300048926 Ga0496123_0003061 Ga0496123_0003061_16102_16980 292
52 3300048928 Ga0496125_0034851 Ga0496125_0034851_2210_3088 292
53 iso_pu_bacteria 2582581279 2585149644 292
54 iso_pu_bacteria 2808606404 2809081374 292
55 iso_pu_bacteria 2880518877 2880523774 292
56 iso_pu_bacteria 8054302542 8054307601 292
57 3300009176 Ga0105242_10534266 Ga0105242_105342661 293
58 3300046500 Ga0495596_0002376 Ga0495596_0002376_7890_8771 293
59 2162886007 SwRhRL2b_contig_688890 SwRhRL2b_0280.00005000 294
60 3300001979 JGI24740J21852_10000363 JGI24740J21852_1000036312 294
61 3300002074 JGI24748J21848_1000643 JGI24748J21848_10006434 294
62 3300005289 Ga0065704_10000277 Ga0065704_1000027749 294
63 3300005347 Ga0070668_100002474 Ga0070668_1000024749 294
64 3300005353 Ga0070669_100000039 Ga0070669_10000003967 294
65 3300005355 Ga0070671_100004551 Ga0070671_1000045518 294
66 3300005367 Ga0070667_100000719 Ga0070667_10000071912 294
67 3300005455 Ga0070663_100035287 Ga0070663_1000352872 294
68 3300005548 Ga0070665_100001414 Ga0070665_10000141422 294
69 3300005843 Ga0068860_100004085 Ga0068860_10000408511 294
70 3300009101 Ga0105247_10013032 Ga0105247_100130325 294
71 3300025711 Ga0207696_1009712 Ga0207696_10097122 294
72 3300025923 Ga0207681_10000144 Ga0207681_100001449 294
73 3300025931 Ga0207644_10022162 Ga0207644_100221623 294
74 3300025972 Ga0207668_10001544 Ga0207668_100015443 294
75 3300025986 Ga0207658_10000216 Ga0207658_1000021635 294
76 3300026067 Ga0207678_10053600 Ga0207678_100536002 294
77 3300028379 Ga0268266_10024222 Ga0268266_100242222 294
78 3300028380 Ga0268265_10166007 Ga0268265_101660072 294
79 3300028381 Ga0268264_10003503 Ga0268264_100035033 294
80 3300046460 Ga0495638_0000607 Ga0495638_0000607_23734_24627 294
81 3300046512 Ga0495610_0000243 Ga0495610_0000243_48880_49764 294
82 3300046515 Ga0495620_0002894 Ga0495620_0002894_7389_8273 294
83 3300048091 Ga0495626_0001225 Ga0495626_0001225_5345_6229 294
84 3300048903 Ga0496100_0025383 Ga0496100_0025383_2595_3479 294
85 3300048904 Ga0496101_0180745 Ga0496101_0180745_160_1044 294
86 3300048905 Ga0496102_0000698 Ga0496102_0000698_4785_5669 294
87 3300048906 Ga0496103_0000258 Ga0496103_0000258_22317_23201 294
88 3300048907 Ga0496104_0000675 Ga0496104_0000675_25768_26652 294
89 3300048907 Ga0496104_0367570 Ga0496104_0367570_123_1007 294
90 3300048908 Ga0496105_0000184 Ga0496105_0000184_25785_26669 294
91 3300048908 Ga0496105_0056984 Ga0496105_0056984_1914_2798 294
92 3300048915 Ga0496112_0457174 Ga0496112_0457174_253_1137 294
93 3300048919 Ga0496116_0001606 Ga0496116_0001606_15741_16625 294
94 3300048919 Ga0496116_0038217 Ga0496116_0038217_580_1464 294
95 3300048920 Ga0496117_0010819 Ga0496117_0010819_6674_7558 294
96 3300048921 Ga0496118_0036593 Ga0496118_0036593_678_1562 294
97 3300048922 Ga0496119_0001028 Ga0496119_0001028_9082_9966 294
98 3300048922 Ga0496119_0056741 Ga0496119_0056741_739_1623 294
99 3300048923 Ga0496120_0000961 Ga0496120_0000961_17205_18089 294
100 3300048923 Ga0496120_0030393 Ga0496120_0030393_2306_3190 294
101 3300048924 Ga0496121_0006397 Ga0496121_0006397_1997_2881 294
102 3300048925 Ga0496122_0003011 Ga0496122_0003011_1627_2511 294
103 3300048926 Ga0496123_0002688 Ga0496123_0002688_16354_17238 294
104 3300048927 Ga0496124_0010844 Ga0496124_0010844_1733_2617 294
105 3300048929 Ga0496126_0000158 Ga0496126_0000158_42346_43230 294
106 2162886007 SwRhRL2b_contig_2292987 SwRhRL2b_0423.00007130 295
107 3300005289 Ga0065704_10070346 Ga0065704_100703469 295
108 3300005614 Ga0068856_100004335 Ga0068856_1000043352 295
109 3300009553 Ga0105249_10000722 Ga0105249_100007225 295
110 3300013102 Ga0157371_10000001 Ga0157371_10000001546 295
111 3300013104 Ga0157370_10022700 Ga0157370_100227006 295
112 3300014497 Ga0182008_10052251 Ga0182008_100522512 295
113 3300025961 Ga0207712_10000559 Ga0207712_100005595 295
114 3300026078 Ga0207702_10043529 Ga0207702_100435294 295
115 3300038443 Ga0395901_0541040 Ga0395901_0541040_266_1156 295
116 3300042139 Ga0450904_000137 Ga0450904_000137_14806_15711 295
117 3300046453 Ga0495627_000432 Ga0495627_000432_29528_30415 295
118 3300046474 Ga0495605_0034541 Ga0495605_0034541_538_1443 295
119 3300046506 Ga0495583_0000727 Ga0495583_0000727_8167_9072 295
120 3300046513 Ga0495616_0000049 Ga0495616_0000049_89688_90593 295
121 3300046520 Ga0495637_0024441 Ga0495637_0024441_30_935 295
122 3300046522 Ga0495643_0000224 Ga0495643_0000224_24965_25870 295
123 3300046558 Ga0495633_0046698 Ga0495633_0046698_801_1688 295
124 3300047470 Ga0495681_0000179 Ga0495681_0000179_35271_36158 295
125 3300047472 Ga0495686_0008456 Ga0495686_0008456_5042_5929 295
126 3300048091 Ga0495626_0000219 Ga0495626_0000219_55206_56111 295
127 3300048926 Ga0496123_0148202 Ga0496123_0148202_266_1153 295
128 3300049571 Ga0501034_0015730 Ga0501034_0015730_4659_5552 295
129 3300049581 Ga0501047_0307023 Ga0501047_0307023_467_1360 295
130 iso_pu_bacteria 8005658619 8005659990 295
131 3300001915 JGI24741J21665_1001553 JGI24741J21665_10015535 296
132 3300002067 JGI24735J21928_10006185 JGI24735J21928_100061852 296
133 3300005539 Ga0068853_100000580 Ga0068853_1000005808 296
134 3300005577 Ga0068857_100313230 Ga0068857_1003132302 296
135 3300005841 Ga0068863_100037533 Ga0068863_1000375335 296
136 3300009551 Ga0105238_10092343 Ga0105238_100923433 296
137 3300013102 Ga0157371_10025351 Ga0157371_100253513 296
138 3300013307 Ga0157372_10007486 Ga0157372_100074863 296
139 3300025924 Ga0207694_10026644 Ga0207694_100266442 296
140 3300025931 Ga0207644_10019639 Ga0207644_100196395 296
141 3300026041 Ga0207639_10001421 Ga0207639_1000142116 296
142 3300046453 Ga0495627_001001 Ga0495627_001001_14900_15790 296
143 3300046471 Ga0495650_0011475 Ga0495650_0011475_615_1505 296
144 3300046500 Ga0495596_0001695 Ga0495596_0001695_1078_1968 296
145 3300046512 Ga0495610_0000082 Ga0495610_0000082_11952_12842 296
146 3300046538 Ga0495609_0038923 Ga0495609_0038923_522_1412 296
147 3300046558 Ga0495633_0001232 Ga0495633_0001232_5622_6512 296
148 3300046660 Ga0495625_0005611 Ga0495625_0005611_4903_5793 296
149 3300046660 Ga0495625_0049679 Ga0495625_0049679_1483_2373 296
150 3300046692 Ga0495671_0061229 Ga0495671_0061229_343_1233 296
151 3300047470 Ga0495681_0001625 Ga0495681_0001625_13988_14878 296
152 3300048911 Ga0496108_0008596 Ga0496108_0008596_2479_3369 296
153 3300048924 Ga0496121_0001607 Ga0496121_0001607_34137_35027 296
154 3300048927 Ga0496124_0000946 Ga0496124_0000946_41429_42319 296
155 3300048927 Ga0496124_0028128 Ga0496124_0028128_2611_3501 296
156 3300048929 Ga0496126_0002551 Ga0496126_0002551_9411_10301 296
157 3300049574 Ga0501038_0003137 Ga0501038_0003137_7522_8412 296
158 3300049669 Ga0501235_008254 Ga0501235_008254_1158_2048 296
159 3300053157 Ga0500624_000225 Ga0500624_000225_7266_8156 296
160 3300053177 Ga0500636_0000126 Ga0500636_0000126_10897_11787 296
161 3300044684 Ga0466966_0047410 Ga0466966_0047410_636_1541 298
162 3300046506 Ga0495583_0000122 Ga0495583_0000122_103968_104870 298
163 3300046536 Ga0495587_0009019 Ga0495587_0009019_3610_4512 298
164 3300046558 Ga0495633_0014184 Ga0495633_0014184_499_1401 298
165 3300046809 Ga0495600_0002050 Ga0495600_0002050_8770_9672 298
166 3300003775 Ga0055524_1001890 Ga0055524_10018908 299
167 3300013105 Ga0157369_10263253 Ga0157369_102632532 299
168 3300017792 Ga0163161_10029234 Ga0163161_100292341 299
169 3300025299 Ga0209256_1000122 Ga0209256_1000122145 299
170 3300048912 Ga0496109_0557679 Ga0496109_0557679_144_1055 299
171 iso_pu_bacteria 2643221610 2644068323 299
172 iso_pu_bacteria 2643221675 2644419249 299
173 iso_pu_bacteria 2643221680 2644452606 299
174 iso_pu_bacteria 2643221726 2644691380 299
175 2162886007 SwRhRL2b_contig_2038536 SwRhRL2b_0138.00010760 300
176 3300001979 JGI24740J21852_10000770 JGI24740J21852_1000077010 300
177 3300001989 JGI24739J22299_10012119 JGI24739J22299_100121192 300
178 3300005289 Ga0065704_10001247 Ga0065704_1000124710 300
179 3300009093 Ga0105240_10170920 Ga0105240_101709203 300
180 3300013104 Ga0157370_10044458 Ga0157370_100444582 300
181 3300013105 Ga0157369_10043417 Ga0157369_100434175 300
182 3300025913 Ga0207695_10128593 Ga0207695_101285932 300
183 3300031731 Ga0307405_10297252 Ga0307405_102972521 300
184 3300031911 Ga0307412_10073045 Ga0307412_100730452 300
185 3300048919 Ga0496116_0144693 Ga0496116_0144693_298_1200 300
186 3300048927 Ga0496124_0001488 Ga0496124_0001488_12468_13370 300
187 3300048927 Ga0496124_0004303 Ga0496124_0004303_1042_1944 300
188 3300048928 Ga0496125_0041191 Ga0496125_0041191_982_1884 300
189 3300048929 Ga0496126_0001697 Ga0496126_0001697_21032_21934 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

293

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

200

0.93

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

25

162

0.93

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

21

235

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

32

153

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9691 1 292
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9624 1 292
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9515 2 287
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9509 2 287
8ctr-assembly4.cif.gz_D crystal structure of dtdp-4-dehydrorhamnose reductase from klebsiella pneumoniae with bound nadp 0.9443 1 291
ID Description Score Start End Superfamily
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9508 3 217 3.40.50.720
3sc6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 2 218 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9349 1 291 3.40.50.720
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 2 218 3.40.50.720
1n2sA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9208 1 278 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1I1BMY0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9926 1 291 GO:0008831
GO:0019305
AF-A0A1W2DRE1-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9891 1 290 GO:0008831
GO:0019305
AF-A0A436FP44-F1-model_v4 deleted 0.9889 42 293
AF-A0A1E4DMV8-F1-model_v4 deleted 0.9887 1 232
AF-A0A2E1HDB2-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9881 1 291 GO:0008831
GO:0019305

Feature Viewer

pLDDT pTM Quality
95.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map