F290017

General Info

Members Datasets Scaffolds Average Seq Length
188 131 376 188

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0301476|Ga0501067_0301476_180_779
Length 199
Sequence MATTSIRITGDERADEVLSDDPFALLLGMLLDQQYPMEHAFRGPAKVLERFGTLDPAQIAAAEPEQFASMCAEPPAVHRFPGSMAGRIQAVAQAVVADYDGHAERIWTEAADAGDLIRRMTALPGFGAQKAKIFVALLAKQLGVRPDGWERAVGDYSLEGYRSVADVVDAESLEKVRAFKKEKKAAARSSADAGPVARS

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
69 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
70 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
71 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
124 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
125 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
126 2643221641 Nocardioides sp. Root122 Isolate Unclassified
127 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
128 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
129 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
130 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
131 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.02
Metatranscriptomes 3.19
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 9.04
Rhizosphere 82.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0301476 3300049583 Bacteria 892
2 Ga0006562J51391_1101648 3300003578 Bacteria 845
3 Ga0065714_10079085 3300005288 Bacteria 2545
4 Ga0070658_10415930 3300005327 Bacteria 1156
5 Ga0070658_10551173 3300005327 Bacteria 998
6 Ga0070658_10671847 3300005327 Bacteria 899
7 Ga0070683_100291477 3300005329 Bacteria 1552
8 Ga0070670_100481172 3300005331 Bacteria 1103
9 Ga0070682_100120374 3300005337 Bacteria 1761
10 Ga0070660_100195606 3300005339 Bacteria 1639
11 Ga0070660_100243960 3300005339 Bacteria 1464
12 Ga0070660_100545463 3300005339 Bacteria 967
13 Ga0070661_100330004 3300005344 Bacteria 1193
14 Ga0070661_100500160 3300005344 Bacteria 973
15 Ga0068867_100860626 3300005459 Bacteria 813
16 Ga0070684_101132468 3300005535 Bacteria 736
17 Ga0070665_100870378 3300005548 Bacteria 914
18 Ga0070664_100346330 3300005564 Bacteria 1351
19 Ga0068857_100031527 3300005577 Bacteria 4684
20 Ga0068852_100252961 3300005616 Bacteria 1689
21 Ga0068870_10483495 3300005840 Bacteria 822
22 Ga0068870_10640145 3300005840 Bacteria 727
23 Ga0081455_10000172 3300005937 Bacteria 80655
24 Ga0075367_10304149 3300006178 Bacteria 1004
25 Ga0068865_100439736 3300006881 Bacteria 1076
26 Ga0105245_10079452 3300009098 Bacteria 2995
27 Ga0105245_10150517 3300009098 Bacteria 2200
28 Ga0105243_10015490 3300009148 Bacteria 5764
29 Ga0105243_10100616 3300009148 Bacteria 2398
30 Ga0105248_10169871 3300009177 Bacteria 2458
31 Ga0105238_11110223 3300009551 Bacteria 814
32 Ga0105249_10145604 3300009553 Bacteria 2276
33 Ga0105239_10040866 3300010375 Bacteria 5082
34 Ga0105239_10546891 3300010375 Bacteria 1318
35 Ga0105246_10656256 3300011119 Bacteria 914
36 Ga0163162_10482632 3300013306 Bacteria 1371
37 Ga0157372_11600813 3300013307 Bacteria 750
38 Ga0163163_11037824 3300014325 Bacteria 883
39 Ga0157380_11160150 3300014326 Bacteria 814
40 Ga0157377_10160252 3300014745 Bacteria 1398
41 Ga0157377_10517636 3300014745 Bacteria 837
42 Ga0157376_10508765 3300014969 Bacteria 1185
43 Ga0163161_10169352 3300017792 Bacteria 1669
44 Ga0206354_10117596 3300020081 Bacteria 1086
45 Ga0206354_10924514 3300020081 Bacteria 2227
46 Ga0206354_11035542 3300020081 Bacteria 759
47 Ga0206353_10045756 3300020082 Bacteria 2654
48 Ga0206353_10660347 3300020082 Bacteria 1081
49 Ga0207657_10429786 3300025919 Bacteria 1037
50 Ga0207649_10041785 3300025920 Bacteria 2793
51 Ga0207650_11088651 3300025925 Bacteria 680
52 Ga0207659_10196359 3300025926 Bacteria 1609
53 Ga0207690_10175009 3300025932 Bacteria 1611
54 Ga0207690_10289288 3300025932 Bacteria 1279
55 Ga0207709_10292486 3300025935 Bacteria 1208
56 Ga0207674_10019144 3300026116 Bacteria 7422
57 Ga0207675_100204536 3300026118 Bacteria 1897
58 Ga0207683_10038866 3300026121 Bacteria 4150
59 Ga0207698_10410653 3300026142 Bacteria 1296
60 Ga0316575_10055468 3300031665 Bacteria 1578
61 Ga0316575_10081904 3300031665 Bacteria 1302
62 Ga0316579_10006815 3300031691 Bacteria 4680
63 Ga0316576_10013447 3300031727 Bacteria 5440
64 Ga0316576_10073549 3300031727 Bacteria 2525
65 Ga0316578_10062273 3300031728 Bacteria 2199
66 Ga0316578_10125947 3300031728 Bacteria 1540
67 Ga0307405_10299759 3300031731 Bacteria 1219
68 Ga0307405_10980575 3300031731 Bacteria 720
69 Ga0316577_10005824 3300031733 Bacteria 6484
70 Ga0307410_10594712 3300031852 Bacteria 922
71 Ga0307416_100192279 3300032002 Bacteria 1926
72 Ga0307414_10176767 3300032004 Bacteria 1713
73 Ga0307415_100616114 3300032126 Bacteria 968
74 Ga0316583_10044496 3300032133 Bacteria 1569
75 Ga0316585_10038831 3300032137 Bacteria 1513
76 Ga0316574_0001235 3300035398 Bacteria 11911
77 Ga0316574_0086264 3300035398 Bacteria 1997
78 Ga0316582_0004730 3300036647 Bacteria 6930
79 Ga0316582_0014845 3300036647 Bacteria 4435
80 Ga0316584_0014809 3300036712 Bacteria 5569
81 Ga0316584_0074254 3300036712 Bacteria 2549
82 Ga0395899_0349050 3300037312 Bacteria 990
83 Ga0395900_0024606 3300037418 Bacteria 6163
84 Ga0395898_0029281 3300037466 Bacteria 5517
85 Ga0395905_0071893 3300037471 Bacteria 3243
86 Ga0395901_0009072 3300038443 Bacteria 10068
87 Ga0451793_0093726 3300041452 Bacteria 6584
88 Ga0451797_0306688 3300041453 Bacteria 2837
89 Ga0451833_0570333 3300041491 Bacteria 6569
90 Ga0451839_1323906 3300041496 Bacteria 3956
91 Ga0451855_0567172 3300041511 Bacteria 615
92 Ga0439445_0030421 3300042004 Bacteria 1399
93 Ga0466965_0068961 3300044683 Bacteria 1776
94 Ga0466965_0117502 3300044683 Bacteria 1371
95 Ga0466964_0020471 3300044706 Bacteria 2548
96 Ga0466957_0007334 3300044842 Bacteria 6232
97 Ga0466957_0664888 3300044842 Bacteria 733
98 Ga0466960_0097983 3300044901 Bacteria 1505
99 Ga0466960_0144703 3300044901 Bacteria 1265
100 Ga0466967_0070607 3300045976 Bacteria 3124
101 Ga0466967_0358240 3300045976 Bacteria 1413
102 Ga0466967_0676167 3300045976 Bacteria 1022
103 Ga0495641_0068789 3300046461 Bacteria 1592
104 Ga0495586_0296871 3300046535 Bacteria 925
105 Ga0495635_0147593 3300046663 Bacteria 1601
106 Ga0495604_0390892 3300047317 Bacteria 917
107 Ga0495674_0240209 3300047319 Bacteria 1493
108 Ga0495676_0581697 3300047321 Bacteria 730
109 Ga0496100_0077930 3300048903 Bacteria 2230
110 Ga0496100_0225493 3300048903 Bacteria 1377
111 Ga0496102_0035586 3300048905 Bacteria 4483
112 Ga0496102_0756953 3300048905 Bacteria 894
113 Ga0496104_0040154 3300048907 Bacteria 4385
114 Ga0496104_0615110 3300048907 Bacteria 996
115 Ga0496105_0051095 3300048908 Bacteria 3416
116 Ga0496105_0119997 3300048908 Bacteria 2169
117 Ga0496108_0647435 3300048911 Bacteria 919
118 Ga0496109_0567082 3300048912 Bacteria 1070
119 Ga0496110_0029341 3300048913 Bacteria 4733
120 Ga0496110_0674274 3300048913 Bacteria 934
121 Ga0496114_0018700 3300048917 Bacteria 5606
122 Ga0496114_0030746 3300048917 Bacteria 4418
123 Ga0496114_1064629 3300048917 Bacteria 693
124 Ga0501031_0024644 3300049568 Bacteria 3922
125 Ga0501031_0044520 3300049568 Bacteria 2896
126 Ga0501031_0052554 3300049568 Bacteria 2655
127 Ga0501032_0014885 3300049569 Bacteria 5504
128 Ga0501034_0199246 3300049571 Bacteria 1961
129 Ga0501036_0067869 3300049572 Bacteria 3017
130 Ga0501036_0232479 3300049572 Bacteria 1547
131 Ga0501036_0241567 3300049572 Bacteria 1514
132 Ga0501037_0038933 3300049573 Bacteria 3501
133 Ga0501038_0001385 3300049574 Bacteria 22157
134 Ga0501038_0023829 3300049574 Bacteria 5465
135 Ga0501039_0005095 3300049575 Bacteria 9953
136 Ga0501039_0104043 3300049575 Bacteria 2216
137 Ga0501039_0931605 3300049575 Bacteria 676
138 Ga0501040_0025554 3300049576 Bacteria 3971
139 Ga0501040_0136406 3300049576 Bacteria 1728
140 Ga0501041_0075920 3300049577 Bacteria 2067
141 Ga0501041_0328318 3300049577 Bacteria 965
142 Ga0501042_0008948 3300049578 Bacteria 6645
143 Ga0501042_0079885 3300049578 Bacteria 2343
144 Ga0501042_0187487 3300049578 Bacteria 1492
145 Ga0501042_0211076 3300049578 Bacteria 1400
146 Ga0501043_0018060 3300049579 Bacteria 5532
147 Ga0501043_0061631 3300049579 Bacteria 2946
148 Ga0501046_0020273 3300049580 Bacteria 5501
149 Ga0501046_0045104 3300049580 Bacteria 3504
150 Ga0501047_0036791 3300049581 Bacteria 4731
151 Ga0501048_0010075 3300049582 Bacteria 7069
152 Ga0501048_0047058 3300049582 Bacteria 3078
153 Ga0501067_0070746 3300049583 Bacteria 1932
154 Ga0501067_0082856 3300049583 Bacteria 1779
155 Ga0501067_0159526 3300049583 Bacteria 1256
156 Ga0501069_0214637 3300049585 Bacteria 1117
157 Ga0501070_0002691 3300049586 Bacteria 15517
158 Ga0501070_0046401 3300049586 Bacteria 3613
159 Ga0501071_0005855 3300049587 Bacteria 7943
160 Ga0501072_0113587 3300049588 Bacteria 2156
161 Ga0501073_0036957 3300049589 Bacteria 3469
162 Ga0501075_0041498 3300049591 Bacteria 3448
163 Ga0501076_0012139 3300049592 Bacteria 6440
164 Ga0501077_0014061 3300049593 Bacteria 5021
165 Ga0501079_0175341 3300049741 Bacteria 1672
166 Ga0501080_0019422 3300049742 Bacteria 6295
167 Ga0501035_0025192 3300049822 Bacteria 5453
168 Ga0501035_0277857 3300049822 Bacteria 1416
169 Ga0501044_0045142 3300049823 Bacteria 4568
170 Ga0501045_0006467 3300049824 Bacteria 8116
171 Ga0501045_0383345 3300049824 Bacteria 1046
172 nmdc:mga03n38_168235_c1 3300050490 Bacteria 1114
173 nmdc:mga0yw44_362715_c1 3300050492 Bacteria 977
174 nmdc:mga0yw44_866089_c1 3300050492 Bacteria 613
175 Ga0495595_0104399 3300053084 Bacteria 1370
176 Ga0501084_0028530 3300054114 Bacteria 4666
177 Ga0501084_0147220 3300054114 Bacteria 1984
178 Ga0501082_0042216 3300060353 Bacteria 3932
179 Ga0501082_0230199 3300060353 Bacteria 1613
180 2587863485 2585428094 Bacteria 3604039
181 2643851025 2643221567 Bacteria 4163945
182 2644134774 2643221624 Bacteria 4384879
183 2644230267 2643221641 Bacteria 4490190
184 2644537812 2643221697 Bacteria 3575694
185 2739608889 2739367654 Bacteria 6049412
186 2774393309 2773857762 Bacteria 5971770
187 2809197149 2808606439 Bacteria 5952208
188 2919449484 2919446982 Bacteria 3994487
189 Ga0501067_0301476
190 Ga0006562J51391_1101648
191 Ga0065714_10079085
192 Ga0070658_10415930
193 Ga0070658_10551173
194 Ga0070658_10671847
195 Ga0070683_100291477
196 Ga0070670_100481172
197 Ga0070682_100120374
198 Ga0070660_100195606
199 Ga0070660_100243960
200 Ga0070660_100545463
201 Ga0070661_100330004
202 Ga0070661_100500160
203 Ga0068867_100860626
204 Ga0070684_101132468
205 Ga0070665_100870378
206 Ga0070664_100346330
207 Ga0068857_100031527
208 Ga0068852_100252961
209 Ga0068870_10483495
210 Ga0068870_10640145
211 Ga0081455_10000172
212 Ga0075367_10304149
213 Ga0068865_100439736
214 Ga0105245_10079452
215 Ga0105245_10150517
216 Ga0105243_10015490
217 Ga0105243_10100616
218 Ga0105248_10169871
219 Ga0105238_11110223
220 Ga0105249_10145604
221 Ga0105239_10040866
222 Ga0105239_10546891
223 Ga0105246_10656256
224 Ga0163162_10482632
225 Ga0157372_11600813
226 Ga0163163_11037824
227 Ga0157380_11160150
228 Ga0157377_10160252
229 Ga0157377_10517636
230 Ga0157376_10508765
231 Ga0163161_10169352
232 Ga0206354_10117596
233 Ga0206354_10924514
234 Ga0206354_11035542
235 Ga0206353_10045756
236 Ga0206353_10660347
237 Ga0207657_10429786
238 Ga0207649_10041785
239 Ga0207650_11088651
240 Ga0207659_10196359
241 Ga0207690_10175009
242 Ga0207690_10289288
243 Ga0207709_10292486
244 Ga0207674_10019144
245 Ga0207675_100204536
246 Ga0207683_10038866
247 Ga0207698_10410653
248 Ga0316575_10055468
249 Ga0316575_10081904
250 Ga0316579_10006815
251 Ga0316576_10013447
252 Ga0316576_10073549
253 Ga0316578_10062273
254 Ga0316578_10125947
255 Ga0307405_10299759
256 Ga0307405_10980575
257 Ga0316577_10005824
258 Ga0307410_10594712
259 Ga0307416_100192279
260 Ga0307414_10176767
261 Ga0307415_100616114
262 Ga0316583_10044496
263 Ga0316585_10038831
264 Ga0316574_0001235
265 Ga0316574_0086264
266 Ga0316582_0004730
267 Ga0316582_0014845
268 Ga0316584_0014809
269 Ga0316584_0074254
270 Ga0395899_0349050
271 Ga0395900_0024606
272 Ga0395898_0029281
273 Ga0395905_0071893
274 Ga0395901_0009072
275 Ga0451793_0093726
276 Ga0451797_0306688
277 Ga0451833_0570333
278 Ga0451839_1323906
279 Ga0451855_0567172
280 Ga0439445_0030421
281 Ga0466965_0068961
282 Ga0466965_0117502
283 Ga0466964_0020471
284 Ga0466957_0007334
285 Ga0466957_0664888
286 Ga0466960_0097983
287 Ga0466960_0144703
288 Ga0466967_0070607
289 Ga0466967_0358240
290 Ga0466967_0676167
291 Ga0495641_0068789
292 Ga0495586_0296871
293 Ga0495635_0147593
294 Ga0495604_0390892
295 Ga0495674_0240209
296 Ga0495676_0581697
297 Ga0496100_0077930
298 Ga0496100_0225493
299 Ga0496102_0035586
300 Ga0496102_0756953
301 Ga0496104_0040154
302 Ga0496104_0615110
303 Ga0496105_0051095
304 Ga0496105_0119997
305 Ga0496108_0647435
306 Ga0496109_0567082
307 Ga0496110_0029341
308 Ga0496110_0674274
309 Ga0496114_0018700
310 Ga0496114_0030746
311 Ga0496114_1064629
312 Ga0501031_0024644
313 Ga0501031_0044520
314 Ga0501031_0052554
315 Ga0501032_0014885
316 Ga0501034_0199246
317 Ga0501036_0067869
318 Ga0501036_0232479
319 Ga0501036_0241567
320 Ga0501037_0038933
321 Ga0501038_0001385
322 Ga0501038_0023829
323 Ga0501039_0005095
324 Ga0501039_0104043
325 Ga0501039_0931605
326 Ga0501040_0025554
327 Ga0501040_0136406
328 Ga0501041_0075920
329 Ga0501041_0328318
330 Ga0501042_0008948
331 Ga0501042_0079885
332 Ga0501042_0187487
333 Ga0501042_0211076
334 Ga0501043_0018060
335 Ga0501043_0061631
336 Ga0501046_0020273
337 Ga0501046_0045104
338 Ga0501047_0036791
339 Ga0501048_0010075
340 Ga0501048_0047058
341 Ga0501067_0070746
342 Ga0501067_0082856
343 Ga0501067_0159526
344 Ga0501069_0214637
345 Ga0501070_0002691
346 Ga0501070_0046401
347 Ga0501071_0005855
348 Ga0501072_0113587
349 Ga0501073_0036957
350 Ga0501075_0041498
351 Ga0501076_0012139
352 Ga0501077_0014061
353 Ga0501079_0175341
354 Ga0501080_0019422
355 Ga0501035_0025192
356 Ga0501035_0277857
357 Ga0501044_0045142
358 Ga0501045_0006467
359 Ga0501045_0383345
360 nmdc:mga03n38_168235_c1
361 nmdc:mga0yw44_362715_c1
362 nmdc:mga0yw44_866089_c1
363 Ga0495595_0104399
364 Ga0501084_0028530
365 Ga0501084_0147220
366 Ga0501082_0042216
367 Ga0501082_0230199
368 2587863485
369 2643851025
370 2644134774
371 2644230267
372 2644537812
373 2739608889
374 2774393309
375 2809197149
376 2919449484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

27

193

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rdt-assembly1.cif.gz_A structure of human nthl1 - linker 1 chimera 0.7278 20 140
7yho-assembly1.cif.gz_A cryoem structure of arabidopsis ros1 in complex with tg mismatch dsdna at 3.3 angstroms resolution 0.7278 21 134
7rds-assembly1.cif.gz_A structure of human nthl1 0.7172 8 130
3fhf-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii 8-oxoguanine dna glycosylase (mjogg) 0.7157 20 133
7yhq-assembly1.cif.gz_A cryoem structure of arabidopsis ros1 in complex with a covalent-linked reaction intermediate at 3.9 angstroms resolution 0.7127 21 134
ID Description Score Start End Superfamily
af_P95145_45_158_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.797 20 131 1.10.340.30
af_Q9SIC4_169_271_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7882 17 128 1.10.340.30
af_P95145_45_158_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7792 20 131 1.10.340.30
af_Q58829_25_138_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7644 17 128 1.10.340.30
af_Q4CY47_40_146_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7571 20 131 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A355DFI0-F1-model_v4 Fe-S cluster assembly protein HesB 0.9878 103 178
AF-A0A2P2CAC1-F1-model_v4 HhH-GPD family protein 0.9861 1 186 GO:0003824
GO:0006284
AF-A0A5M4FFT2-F1-model_v4 Fe-S cluster assembly protein HesB 0.9854 1 185 GO:0003824
GO:0006284
AF-A0A542VT89-F1-model_v4 deleted 0.9808 1 190
AF-A0A3G8JUX8-F1-model_v4 HhH-GPD domain-containing protein 0.9803 1 185 GO:0003824
GO:0006284

Map