F290003

General Info

Members Datasets Scaffolds Average Seq Length
188 119 376 151

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0094880|Ga0501039_0094880_1079_1588
Length 169
Sequence MVTTFNSNFLYERRQTMTAHGAKIVQTGHVGLNVSNVDRSKRFYQDVFGFAVAGESHEQGRRFVFLGEGDKVVLTLWQQGEGRFEKHLPGLHHLSFQVPAIEDVKDAELRLRTLNVPFIYDGIVPHAEGAQSGGIFFEDPDGIRLEIYAPNGADDRTAPSPGAPSCGFF

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
119 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 0
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 18.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0094880 3300049575 Unclassified 2326
2 rootH1_10192352 3300003323 Bacteria 2536
3 rootH1_10368556 3300003323 Bacteria 2621
4 Ga0070689_100001595 3300005340 Bacteria 14470
5 Ga0070689_100214166 3300005340 Bacteria 1578
6 Ga0070689_100330924 3300005340 Unclassified 1274
7 Ga0070674_100294619 3300005356 Bacteria 1291
8 Ga0070673_100018564 3300005364 Bacteria 4972
9 Ga0070713_102162554 3300005436 Bacteria 539
10 Ga0070681_10232935 3300005458 Bacteria 1756
11 Ga0070706_100257878 3300005467 Bacteria 1628
12 Ga0070698_100225977 3300005471 Unclassified 1805
13 Ga0070679_100002857 3300005530 Bacteria 15694
14 Ga0070697_100073556 3300005536 Unclassified 2806
15 Ga0070672_100000028 3300005543 Bacteria 64492
16 Ga0070672_101355496 3300005543 Bacteria 636
17 Ga0070686_100910064 3300005544 Unclassified 716
18 Ga0070686_101957711 3300005544 Bacteria 501
19 Ga0070695_101405191 3300005545 Unclassified 579
20 Ga0070704_101422813 3300005549 Unclassified 636
21 Ga0068859_100094008 3300005617 Bacteria 3050
22 Ga0068864_100000034 3300005618 Bacteria 199411
23 Ga0068864_102250637 3300005618 Unclassified 551
24 Ga0068861_101382235 3300005719 Bacteria 687
25 Ga0068858_100001504 3300005842 Bacteria 23980
26 Ga0081455_10050473 3300005937 Bacteria 3577
27 Ga0075369_10122217 3300006186 Bacteria 1179
28 Ga0075428_100000560 3300006844 Bacteria 38064
29 Ga0075428_100010128 3300006844 Bacteria 10473
30 Ga0075428_100050539 3300006844 Bacteria 4559
31 Ga0075428_100263428 3300006844 Bacteria 1856
32 Ga0075428_100279133 3300006844 Bacteria 1798
33 Ga0075428_101141271 3300006844 Bacteria 822
34 Ga0075430_100002799 3300006846 Bacteria 14590
35 Ga0075430_100018620 3300006846 Bacteria 5910
36 Ga0075431_100000763 3300006847 Bacteria 27866
37 Ga0075431_100041370 3300006847 Bacteria 4751
38 Ga0075431_100078535 3300006847 Bacteria 3407
39 Ga0075431_100200764 3300006847 Unclassified 2040
40 Ga0075431_101373705 3300006847 Bacteria 666
41 Ga0075433_10939716 3300006852 Unclassified 754
42 Ga0075434_100725799 3300006871 Bacteria 1011
43 Ga0075434_101348159 3300006871 Bacteria 724
44 Ga0075429_100056389 3300006880 Bacteria 3419
45 Ga0075429_100248564 3300006880 Unclassified 1557
46 Ga0075429_101102616 3300006880 Bacteria 693
47 Ga0068865_100230379 3300006881 Unclassified 1453
48 Ga0097620_100094010 3300006931 Bacteria 3050
49 Ga0111539_10005302 3300009094 Bacteria 16691
50 Ga0111539_10093181 3300009094 Bacteria 3539
51 Ga0111539_11681446 3300009094 Bacteria 736
52 Ga0105245_10002175 3300009098 Bacteria 17760
53 Ga0114129_10132697 3300009147 Bacteria 3419
54 Ga0114129_11066820 3300009147 Unclassified 1013
55 Ga0105241_10756484 3300009174 Bacteria 891
56 Ga0105242_11850201 3300009176 Bacteria 643
57 Ga0105237_10000068 3300009545 Bacteria 139028
58 Ga0105237_11815456 3300009545 Bacteria 617
59 Ga0105249_10147291 3300009553 Unclassified 2263
60 Ga0157378_10062448 3300013297 Bacteria 3326
61 Ga0163162_11373849 3300013306 Bacteria 803
62 Ga0157375_10000056 3300013308 Bacteria 123661
63 Ga0157380_10109397 3300014326 Bacteria 2319
64 Ga0157380_11443520 3300014326 Unclassified 740
65 Ga0157380_12079243 3300014326 Bacteria 630
66 Ga0157377_10710573 3300014745 Bacteria 731
67 Ga0213876_10061870 3300021384 Bacteria 1975
68 Ga0207426_1018128 3300025302 Bacteria 2487
69 Ga0207682_10062262 3300025893 Unclassified 1564
70 Ga0207707_10326274 3300025912 Bacteria 1325
71 Ga0207671_10000069 3300025914 Bacteria 160916
72 Ga0207660_10064681 3300025917 Unclassified 2641
73 Ga0207652_10189207 3300025921 Unclassified 1851
74 Ga0207646_10245340 3300025922 Bacteria 1618
75 Ga0207650_10433658 3300025925 Bacteria 1092
76 Ga0207687_10000917 3300025927 Bacteria 20039
77 Ga0207686_10625020 3300025934 Bacteria 850
78 Ga0207670_10003422 3300025936 Bacteria 8421
79 Ga0207670_10148674 3300025936 Bacteria 1735
80 Ga0207704_10168995 3300025938 Bacteria 1566
81 Ga0207691_10003766 3300025940 Bacteria 14728
82 Ga0207691_11518722 3300025940 Bacteria 547
83 Ga0207651_10015115 3300025960 Bacteria 4476
84 Ga0207703_10000660 3300026035 Bacteria 34515
85 Ga0207676_10000020 3300026095 Bacteria 301541
86 Ga0207675_100547876 3300026118 Unclassified 1156
87 Ga0207675_102218805 3300026118 Bacteria 564
88 Ga0207428_10010935 3300027907 Bacteria 8077
89 Ga0307408_100137218 3300031548 Bacteria 1915
90 Ga0307408_100679730 3300031548 Bacteria 923
91 Ga0307408_102172088 3300031548 Unclassified 536
92 Ga0307405_10018319 3300031731 Bacteria 3860
93 Ga0307405_10610972 3300031731 Bacteria 891
94 Ga0307413_10078495 3300031824 Bacteria 2107
95 Ga0307413_10351389 3300031824 Unclassified 1138
96 Ga0307413_10707007 3300031824 Bacteria 838
97 Ga0307413_11752944 3300031824 Bacteria 555
98 Ga0307410_10000439 3300031852 Bacteria 16668
99 Ga0307410_10167411 3300031852 Bacteria 1653
100 Ga0307410_11012036 3300031852 Unclassified 717
101 Ga0307410_11212189 3300031852 Bacteria 658
102 Ga0307406_10394500 3300031901 Bacteria 1095
103 Ga0307406_11390759 3300031901 Unclassified 615
104 Ga0307407_10345400 3300031903 Bacteria 1052
105 Ga0307407_10386186 3300031903 Bacteria 1001
106 Ga0307409_100043711 3300031995 Bacteria 3367
107 Ga0307409_100244182 3300031995 Bacteria 1637
108 Ga0307416_100166049 3300032002 Bacteria 2047
109 Ga0307416_100232132 3300032002 Bacteria 1780
110 Ga0307416_100352541 3300032002 Bacteria 1490
111 Ga0307416_100459500 3300032002 Unclassified 1328
112 Ga0307416_102066984 3300032002 Unclassified 672
113 Ga0307411_10608942 3300032005 Bacteria 940
114 Ga0307415_100011875 3300032126 Bacteria 5010
115 Ga0307415_101636287 3300032126 Unclassified 619
116 Ga0307415_101709737 3300032126 Bacteria 607
117 Ga0373932_0000377 3300035112 Bacteria 13709
118 Ga0373943_0012522 3300035170 Bacteria 3821
119 Ga0395899_0014573 3300037312 Bacteria 6002
120 Ga0395900_0062335 3300037418 Bacteria 3833
121 Ga0395900_0869983 3300037418 Unclassified 826
122 Ga0395898_0059785 3300037466 Bacteria 3706
123 Ga0436365_0216905 3300039437 Bacteria 5752
124 Ga0439461_0000984 3300041410 Bacteria 4272
125 Ga0439466_0021402 3300041411 Bacteria 2292
126 Ga0439431_0029694 3300041997 Bacteria 1351
127 Ga0439445_0008053 3300042004 Bacteria 2459
128 Ga0439434_0007283 3300042435 Bacteria 3243
129 Ga0451577_0717707 3300042876 Bacteria 905
130 Ga0466964_0716758 3300044706 Bacteria 559
131 Ga0453684_0016505 3300044712 Bacteria 11534
132 Ga0466960_0288267 3300044901 Bacteria 922
133 Ga0451576_0471353 3300045051 Unclassified 1318
134 Ga0495668_0001833 3300046616 Bacteria 19216
135 Ga0495588_0387443 3300046674 Bacteria 734
136 Ga0496121_0133225 3300048924 Unclassified 1856
137 Ga0501034_0017498 3300049571 Bacteria 7351
138 Ga0501036_0003545 3300049572 Bacteria 12484
139 Ga0501036_0176235 3300049572 Bacteria 1800
140 Ga0501037_0005510 3300049573 Bacteria 9229
141 Ga0501037_0036100 3300049573 Bacteria 3643
142 Ga0501037_0329897 3300049573 Bacteria 1055
143 Ga0501038_1309370 3300049574 Bacteria 523
144 Ga0501039_0000645 3300049575 Bacteria 25258
145 Ga0501039_0016585 3300049575 Bacteria 5643
146 Ga0501040_0071164 3300049576 Bacteria 2401
147 Ga0501041_0066101 3300049577 Bacteria 2215
148 Ga0501042_0008048 3300049578 Bacteria 6938
149 Ga0501043_0003275 3300049579 Bacteria 13351
150 Ga0501043_0187525 3300049579 Bacteria 1609
151 Ga0501046_0001451 3300049580 Bacteria 22789
152 Ga0501068_0067486 3300049584 Bacteria 2180
153 Ga0501069_0175884 3300049585 Bacteria 1236
154 Ga0501070_0000404 3300049586 Bacteria 39224
155 Ga0501073_0673904 3300049589 Bacteria 714
156 Ga0501074_0011416 3300049590 Bacteria 6460
157 Ga0501075_0193218 3300049591 Bacteria 1552
158 Ga0501075_0685546 3300049591 Bacteria 781
159 Ga0501076_0024670 3300049592 Bacteria 4650
160 Ga0501077_0116112 3300049593 Bacteria 1696
161 Ga0501077_0263625 3300049593 Bacteria 1096
162 Ga0501209_167489 3300049656 Unclassified 667
163 Ga0501257_044558 3300049686 Bacteria 1095
164 Ga0501079_0109233 3300049741 Bacteria 2148
165 Ga0501035_0051987 3300049822 Bacteria 3666
166 Ga0501044_0033974 3300049823 Bacteria 5354
167 Ga0501044_0079539 3300049823 Bacteria 3322
168 Ga0501044_0913705 3300049823 Bacteria 752
169 nmdc:mga05p37_120446_c1 3300050507 Bacteria 3224
170 nmdc:mga09592_1521695_c1 3300050508 Unclassified 544
171 nmdc:mga09592_223511_c1 3300050508 Unclassified 1631
172 nmdc:mga09592_29504_c1 3300050508 Bacteria 4561
173 nmdc:mga09592_551410_c1 3300050508 Bacteria 990
174 nmdc:mga09592_573605_c1 3300050508 Bacteria 968
175 nmdc:mga0qj67_17791_c1 3300050509 Bacteria 5407
176 nmdc:mga0qj67_489030_c1 3300050509 Unclassified 990
177 nmdc:mga0qj67_7280_c1 3300050509 Bacteria 8177
178 nmdc:mga06r32_1258505_c1 3300050510 Bacteria 685
179 nmdc:mga06r32_27057_c1 3300050510 Bacteria 5354
180 nmdc:mga06r32_36541_c1 3300050510 Bacteria 4642
181 nmdc:mga06r32_4713_c1 3300050510 Bacteria 12262
182 nmdc:mga06r32_62346_c1 3300050510 Bacteria 3592
183 nmdc:mga08y16_1307_c1 3300050511 Bacteria 24770
184 nmdc:mga08y16_228818_c1 3300050511 Bacteria 1923
185 nmdc:mga0n895_1593040_c1 3300050512 Unclassified 617
186 nmdc:mga0n895_886255_c1 3300050512 Bacteria 878
187 2968564546 2968558590 Bacteria 6956864
188 8055181309 8055172936 Bacteria 9305943
189 Ga0501039_0094880
190 rootH1_10192352
191 rootH1_10368556
192 Ga0070689_100001595
193 Ga0070689_100214166
194 Ga0070689_100330924
195 Ga0070674_100294619
196 Ga0070673_100018564
197 Ga0070713_102162554
198 Ga0070681_10232935
199 Ga0070706_100257878
200 Ga0070698_100225977
201 Ga0070679_100002857
202 Ga0070697_100073556
203 Ga0070672_100000028
204 Ga0070672_101355496
205 Ga0070686_100910064
206 Ga0070686_101957711
207 Ga0070695_101405191
208 Ga0070704_101422813
209 Ga0068859_100094008
210 Ga0068864_100000034
211 Ga0068864_102250637
212 Ga0068861_101382235
213 Ga0068858_100001504
214 Ga0081455_10050473
215 Ga0075369_10122217
216 Ga0075428_100000560
217 Ga0075428_100010128
218 Ga0075428_100050539
219 Ga0075428_100263428
220 Ga0075428_100279133
221 Ga0075428_101141271
222 Ga0075430_100002799
223 Ga0075430_100018620
224 Ga0075431_100000763
225 Ga0075431_100041370
226 Ga0075431_100078535
227 Ga0075431_100200764
228 Ga0075431_101373705
229 Ga0075433_10939716
230 Ga0075434_100725799
231 Ga0075434_101348159
232 Ga0075429_100056389
233 Ga0075429_100248564
234 Ga0075429_101102616
235 Ga0068865_100230379
236 Ga0097620_100094010
237 Ga0111539_10005302
238 Ga0111539_10093181
239 Ga0111539_11681446
240 Ga0105245_10002175
241 Ga0114129_10132697
242 Ga0114129_11066820
243 Ga0105241_10756484
244 Ga0105242_11850201
245 Ga0105237_10000068
246 Ga0105237_11815456
247 Ga0105249_10147291
248 Ga0157378_10062448
249 Ga0163162_11373849
250 Ga0157375_10000056
251 Ga0157380_10109397
252 Ga0157380_11443520
253 Ga0157380_12079243
254 Ga0157377_10710573
255 Ga0213876_10061870
256 Ga0207426_1018128
257 Ga0207682_10062262
258 Ga0207707_10326274
259 Ga0207671_10000069
260 Ga0207660_10064681
261 Ga0207652_10189207
262 Ga0207646_10245340
263 Ga0207650_10433658
264 Ga0207687_10000917
265 Ga0207686_10625020
266 Ga0207670_10003422
267 Ga0207670_10148674
268 Ga0207704_10168995
269 Ga0207691_10003766
270 Ga0207691_11518722
271 Ga0207651_10015115
272 Ga0207703_10000660
273 Ga0207676_10000020
274 Ga0207675_100547876
275 Ga0207675_102218805
276 Ga0207428_10010935
277 Ga0307408_100137218
278 Ga0307408_100679730
279 Ga0307408_102172088
280 Ga0307405_10018319
281 Ga0307405_10610972
282 Ga0307413_10078495
283 Ga0307413_10351389
284 Ga0307413_10707007
285 Ga0307413_11752944
286 Ga0307410_10000439
287 Ga0307410_10167411
288 Ga0307410_11012036
289 Ga0307410_11212189
290 Ga0307406_10394500
291 Ga0307406_11390759
292 Ga0307407_10345400
293 Ga0307407_10386186
294 Ga0307409_100043711
295 Ga0307409_100244182
296 Ga0307416_100166049
297 Ga0307416_100232132
298 Ga0307416_100352541
299 Ga0307416_100459500
300 Ga0307416_102066984
301 Ga0307411_10608942
302 Ga0307415_100011875
303 Ga0307415_101636287
304 Ga0307415_101709737
305 Ga0373932_0000377
306 Ga0373943_0012522
307 Ga0395899_0014573
308 Ga0395900_0062335
309 Ga0395900_0869983
310 Ga0395898_0059785
311 Ga0436365_0216905
312 Ga0439461_0000984
313 Ga0439466_0021402
314 Ga0439431_0029694
315 Ga0439445_0008053
316 Ga0439434_0007283
317 Ga0451577_0717707
318 Ga0466964_0716758
319 Ga0453684_0016505
320 Ga0466960_0288267
321 Ga0451576_0471353
322 Ga0495668_0001833
323 Ga0495588_0387443
324 Ga0496121_0133225
325 Ga0501034_0017498
326 Ga0501036_0003545
327 Ga0501036_0176235
328 Ga0501037_0005510
329 Ga0501037_0036100
330 Ga0501037_0329897
331 Ga0501038_1309370
332 Ga0501039_0000645
333 Ga0501039_0016585
334 Ga0501040_0071164
335 Ga0501041_0066101
336 Ga0501042_0008048
337 Ga0501043_0003275
338 Ga0501043_0187525
339 Ga0501046_0001451
340 Ga0501068_0067486
341 Ga0501069_0175884
342 Ga0501070_0000404
343 Ga0501073_0673904
344 Ga0501074_0011416
345 Ga0501075_0193218
346 Ga0501075_0685546
347 Ga0501076_0024670
348 Ga0501077_0116112
349 Ga0501077_0263625
350 Ga0501209_167489
351 Ga0501257_044558
352 Ga0501079_0109233
353 Ga0501035_0051987
354 Ga0501044_0033974
355 Ga0501044_0079539
356 Ga0501044_0913705
357 nmdc:mga05p37_120446_c1
358 nmdc:mga09592_1521695_c1
359 nmdc:mga09592_223511_c1
360 nmdc:mga09592_29504_c1
361 nmdc:mga09592_551410_c1
362 nmdc:mga09592_573605_c1
363 nmdc:mga0qj67_17791_c1
364 nmdc:mga0qj67_489030_c1
365 nmdc:mga0qj67_7280_c1
366 nmdc:mga06r32_1258505_c1
367 nmdc:mga06r32_27057_c1
368 nmdc:mga06r32_36541_c1
369 nmdc:mga06r32_4713_c1
370 nmdc:mga06r32_62346_c1
371 nmdc:mga08y16_1307_c1
372 nmdc:mga08y16_228818_c1
373 nmdc:mga0n895_1593040_c1
374 nmdc:mga0n895_886255_c1
375 2968564546
376 8055181309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

147

0.91

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8593 5 135
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8558 7 134
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8435 7 134
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8319 7 135
7n7g-assembly1.cif.gz_B crystal structure of fosb from enterococcus faecium with fosfomycin 0.8272 7 133
ID Description Score Start End Superfamily
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8322 7 135 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8273 15 134 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 10 133 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8208 77 134 3.30.720.110
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.813 11 136 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W1NR95-F1-model_v4 VOC family protein 0.9865 8 144 GO:0004462
GO:0046872
AF-A0A7W1NR95-F1-model_v4 VOC family protein 0.9724 8 144 GO:0004462
GO:0046872
AF-A0A346XTP3-F1-model_v4 Biphenyl-2,3-diol 1,2-dioxygenase 0.9672 5 153 GO:0051213
AF-A0A346XTP3-F1-model_v4 Biphenyl-2,3-diol 1,2-dioxygenase 0.9609 5 153 GO:0051213
AF-A0A0Q6Z0P0-F1-model_v4 Glyoxalase 0.9601 7 153 GO:0004462
GO:0046872

Map