F289989

General Info

Members Datasets Scaffolds Average Seq Length
188 108 376 195

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000986|Ga0501034_0000986_8257_8934
Length 225
Sequence MSARGPGTSRVAQGAAAERNPSRTAGAAPKPRAKRTARPPQPGALLLFPGAGSAASHPSLRAIEQAVRPLPTTRADFPYRKEGRRAPDRPPKLLACVEEEAAKLAKRAKVDPDRLVLGGRSMGGRMCSIAVADGLPACGLVLISYPLHPPGKPDNLRIEHLPRIAVPCLFISGTKDPFGTPAELEQHAAAIAGPVEHVWLEGKGHDLKGCDDLIAEAVSRWLAAR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
26 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
39 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
40 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
41 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
42 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
43 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
47 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
48 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
51 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
52 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
55 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
56 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
57 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
58 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
59 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
60 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
61 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
78 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
103 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
104 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 0.53
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000986 3300049571 Bacteria 40824
2 Ga0070675_101280945 3300005354 Bacteria 675
3 Ga0070671_100003792 3300005355 Bacteria 11859
4 Ga0070714_100304646 3300005435 Unclassified 1486
5 Ga0070714_100803133 3300005435 Unclassified 911
6 Ga0070681_10046209 3300005458 Bacteria 4353
7 Ga0070672_100300187 3300005543 Bacteria 1361
8 Ga0068856_100134201 3300005614 Bacteria 2481
9 Ga0068861_100066091 3300005719 Bacteria 2787
10 Ga0068861_101014746 3300005719 Bacteria 793
11 Ga0068858_100122401 3300005842 Bacteria 2434
12 Ga0081455_10119515 3300005937 Bacteria 2078
13 Ga0075365_10032247 3300006038 Bacteria 3366
14 Ga0075365_10057047 3300006038 Bacteria 2598
15 Ga0075365_10175456 3300006038 Bacteria 1497
16 Ga0075363_100160905 3300006048 Bacteria 1271
17 Ga0075363_100333177 3300006048 Unclassified 884
18 Ga0075367_10051572 3300006178 Bacteria 2432
19 Ga0097621_100469214 3300006237 Bacteria 1136
20 Ga0075428_100044017 3300006844 Bacteria 4907
21 Ga0075428_100580498 3300006844 Bacteria 1198
22 Ga0075428_101018657 3300006844 Bacteria 876
23 Ga0075430_100000666 3300006846 Bacteria 26227
24 Ga0075430_100031972 3300006846 Bacteria 4467
25 Ga0075431_100000612 3300006847 Bacteria 30144
26 Ga0075431_100018952 3300006847 Bacteria 7010
27 Ga0075431_100043187 3300006847 Bacteria 4652
28 Ga0075431_100191746 3300006847 Bacteria 2094
29 Ga0075429_100000737 3300006880 Bacteria 25642
30 Ga0075429_100172300 3300006880 Bacteria 1896
31 Ga0075429_100182863 3300006880 Bacteria 1837
32 Ga0111539_10021614 3300009094 Bacteria 7915
33 Ga0111539_10073597 3300009094 Bacteria 4028
34 Ga0111539_11139917 3300009094 Bacteria 906
35 Ga0105245_10423502 3300009098 Bacteria 1335
36 Ga0114129_10002421 3300009147 Bacteria 25901
37 Ga0114129_10125496 3300009147 Bacteria 3529
38 Ga0114129_10198451 3300009147 Bacteria 2719
39 Ga0105243_10753196 3300009148 Bacteria 955
40 Ga0157373_10494816 3300013100 Bacteria 883
41 Ga0157380_10290160 3300014326 Bacteria 1502
42 Ga0213873_10002490 3300021358 Unclassified 3189
43 Ga0224572_1011679 3300024225 Bacteria 1661
44 Ga0207707_10113394 3300025912 Bacteria 2369
45 Ga0207707_10463009 3300025912 Unclassified 1084
46 Ga0207644_10002939 3300025931 Bacteria 10974
47 Ga0207703_10101379 3300026035 Bacteria 2441
48 Ga0207702_10138669 3300026078 Bacteria 2198
49 Ga0207648_10704874 3300026089 Bacteria 935
50 Ga0207675_100097308 3300026118 Bacteria 2771
51 Ga0207675_101241486 3300026118 Bacteria 766
52 Ga0207428_10031038 3300027907 Bacteria 4415
53 Ga0207428_10133204 3300027907 Bacteria 1901
54 Ga0307408_100096763 3300031548 Bacteria 2241
55 Ga0307413_10157402 3300031824 Bacteria 1592
56 Ga0307407_10551859 3300031903 Bacteria 852
57 Ga0307411_10463765 3300032005 Bacteria 1063
58 Ga0373928_0001303 3300035084 Bacteria 4908
59 Ga0373929_0004763 3300035085 Bacteria 2431
60 Ga0373932_0000378 3300035112 Bacteria 13707
61 Ga0373932_0178102 3300035112 Bacteria 744
62 Ga0373931_0000010 3300035691 Bacteria 334069
63 Ga0373931_0000115 3300035691 Bacteria 36787
64 Ga0400483_103237 3300039062 Bacteria 10402
65 Ga0400483_127381 3300039062 Bacteria 5821
66 Ga0400483_215430 3300039062 Bacteria 3304
67 Ga0436365_1604231 3300039437 Bacteria 4263
68 Ga0436362_0562153 3300039453 Bacteria 5303
69 Ga0451853_0397199 3300041512 Bacteria 1887
70 Ga0439434_0004462 3300042435 Bacteria 4092
71 Ga0451577_0001613 3300042876 Bacteria 29346
72 Ga0453684_0001477 3300044712 Bacteria 66338
73 Ga0495629_0180538 3300046459 Bacteria 1463
74 Ga0495641_0262615 3300046461 Bacteria 777
75 Ga0495653_0050545 3300046463 Bacteria 3197
76 Ga0495618_0384845 3300046514 Bacteria 860
77 Ga0495628_0229856 3300046516 Bacteria 1391
78 Ga0495667_0067903 3300046559 Bacteria 2329
79 Ga0495635_0190152 3300046663 Unclassified 1394
80 Ga0495599_0376053 3300046678 Bacteria 849
81 Ga0495658_0085508 3300046683 Bacteria 1859
82 Ga0495674_0364624 3300047319 Bacteria 1171
83 Ga0495680_0412232 3300047322 Unclassified 931
84 Ga0495684_0049661 3300047471 Bacteria 3205
85 Ga0496111_0495227 3300048914 Bacteria 900
86 Ga0496126_0248029 3300048929 Bacteria 1485
87 Ga0501031_0009118 3300049568 Bacteria 6454
88 Ga0501032_0030351 3300049569 Bacteria 3709
89 Ga0501032_0151497 3300049569 Bacteria 1525
90 Ga0501033_0000068 3300049570 Bacteria 98461
91 Ga0501034_0173807 3300049571 Bacteria 2120
92 Ga0501036_0004810 3300049572 Bacteria 10917
93 Ga0501036_0022520 3300049572 Bacteria 5300
94 Ga0501036_0273513 3300049572 Bacteria 1414
95 Ga0501036_0944649 3300049572 Bacteria 707
96 Ga0501037_0078164 3300049573 Bacteria 2401
97 Ga0501037_0125949 3300049573 Bacteria 1839
98 Ga0501037_0395235 3300049573 Bacteria 949
99 Ga0501038_0072995 3300049574 Bacteria 2907
100 Ga0501038_0104355 3300049574 Bacteria 2356
101 Ga0501039_0005821 3300049575 Bacteria 9335
102 Ga0501039_0133326 3300049575 Unclassified 1950
103 Ga0501039_0461076 3300049575 Bacteria 998
104 Ga0501040_0077530 3300049576 Unclassified 2299
105 Ga0501041_0030626 3300049577 Bacteria 3248
106 Ga0501041_0036091 3300049577 Bacteria 2996
107 Ga0501041_0127376 3300049577 Bacteria 1585
108 Ga0501042_0608415 3300049578 Bacteria 794
109 Ga0501046_0038885 3300049580 Bacteria 3815
110 Ga0501046_0752508 3300049580 Bacteria 684
111 Ga0501047_0453303 3300049581 Bacteria 1112
112 Ga0501047_0454704 3300049581 Bacteria 1110
113 Ga0501048_0028246 3300049582 Bacteria 4072
114 Ga0501048_0138719 3300049582 Bacteria 1719
115 Ga0501067_0004988 3300049583 Bacteria 7377
116 Ga0501067_0036410 3300049583 Bacteria 2732
117 Ga0501068_0003267 3300049584 Bacteria 8689
118 Ga0501068_0294821 3300049584 Bacteria 1038
119 Ga0501069_0218282 3300049585 Bacteria 1108
120 Ga0501070_0000914 3300049586 Bacteria 26839
121 Ga0501070_0020281 3300049586 Bacteria 5576
122 Ga0501070_0121925 3300049586 Bacteria 2155
123 Ga0501070_0309422 3300049586 Bacteria 1286
124 Ga0501071_0034396 3300049587 Bacteria 3606
125 Ga0501071_0132455 3300049587 Bacteria 1853
126 Ga0501071_0144642 3300049587 Bacteria 1772
127 Ga0501071_0698361 3300049587 Bacteria 781
128 Ga0501072_0003041 3300049588 Bacteria 12653
129 Ga0501072_0007329 3300049588 Bacteria 8368
130 Ga0501072_0009762 3300049588 Bacteria 7299
131 Ga0501072_0115146 3300049588 Bacteria 2140
132 Ga0501072_0378114 3300049588 Bacteria 1124
133 Ga0501073_0005251 3300049589 Bacteria 9712
134 Ga0501073_0119975 3300049589 Bacteria 1822
135 Ga0501074_0087438 3300049590 Bacteria 2232
136 Ga0501075_0005478 3300049591 Bacteria 8679
137 Ga0501075_0015554 3300049591 Bacteria 5460
138 Ga0501075_0032408 3300049591 Bacteria 3882
139 Ga0501076_0016149 3300049592 Bacteria 5652
140 Ga0501076_0134441 3300049592 Bacteria 2007
141 Ga0501077_0025156 3300049593 Bacteria 3781
142 Ga0501079_0014256 3300049741 Bacteria 6060
143 Ga0501079_0018586 3300049741 Bacteria 5309
144 Ga0501079_0751683 3300049741 Bacteria 767
145 Ga0501080_0032295 3300049742 Bacteria 4881
146 Ga0501081_0005886 3300049743 Bacteria 7937
147 Ga0501081_0008972 3300049743 Bacteria 6502
148 Ga0501081_0271861 3300049743 Bacteria 1240
149 Ga0501083_0028225 3300049744 Bacteria 3870
150 Ga0501035_0194659 3300049822 Unclassified 1742
151 Ga0501044_0007743 3300049823 Bacteria 11810
152 Ga0501045_0008340 3300049824 Bacteria 7217
153 Ga0501045_0015644 3300049824 Bacteria 5382
154 Ga0501045_0025255 3300049824 Bacteria 4270
155 Ga0501045_0157718 3300049824 Bacteria 1688
156 nmdc:mga03n38_126841_c1 3300050490 Bacteria 1260
157 nmdc:mga0yw44_124940_c1 3300050492 Bacteria 1660
158 nmdc:mga0yw44_1790_c1 3300050492 Bacteria 3456
159 nmdc:mga06z11_60134_c1 3300050494 Bacteria 1977
160 nmdc:mga05p37_301192_c1 3300050507 Bacteria 1905
161 nmdc:mga05p37_667861_c1 3300050507 Bacteria 1161
162 nmdc:mga09592_211182_c1 3300050508 Bacteria 1682
163 nmdc:mga09592_291457_c1 3300050508 Bacteria 1415
164 nmdc:mga09592_380826_c1 3300050508 Bacteria 1220
165 nmdc:mga0qj67_10045_c1 3300050509 Bacteria 5708
166 nmdc:mga0qj67_108044_c1 3300050509 Bacteria 2244
167 nmdc:mga0qj67_60642_c1 3300050509 Bacteria 3003
168 nmdc:mga0qj67_820861_c1 3300050509 Bacteria 735
169 nmdc:mga06r32_144_c1 3300050510 Bacteria 53470
170 nmdc:mga06r32_15760_c1 3300050510 Bacteria 6870
171 nmdc:mga06r32_269342_c1 3300050510 Bacteria 1691
172 nmdc:mga08y16_169512_c1 3300050511 Bacteria 2267
173 nmdc:mga08y16_711028_c1 3300050511 Bacteria 1004
174 nmdc:mga08y16_843505_c1 3300050511 Bacteria 906
175 Ga0495595_0139246 3300053084 Bacteria 1190
176 Ga0495619_0195526 3300053085 Bacteria 1400
177 Ga0500566_0000935 3300053094 Bacteria 16720
178 Ga0500568_0048341 3300053139 Bacteria 1682
179 Ga0501084_0006842 3300054114 Bacteria 9385
180 Ga0501084_0028555 3300054114 Bacteria 4663
181 Ga0501082_0029897 3300060353 Bacteria 4693
182 Ga0501082_0030820 3300060353 Bacteria 4623
183 Ga0501082_0215893 3300060353 Bacteria 1669
184 Ga0501082_0304129 3300060353 Bacteria 1389
185 Ga0501082_0306372 3300060353 Bacteria 1383
186 Ga0501082_0695491 3300060353 Unclassified 890
187 Ga0530510_0005695 3300061734 Bacteria 8631
188 Ga0530510_0013748 3300061734 Bacteria 5698
189 Ga0501034_0000986
190 Ga0070675_101280945
191 Ga0070671_100003792
192 Ga0070714_100304646
193 Ga0070714_100803133
194 Ga0070681_10046209
195 Ga0070672_100300187
196 Ga0068856_100134201
197 Ga0068861_100066091
198 Ga0068861_101014746
199 Ga0068858_100122401
200 Ga0081455_10119515
201 Ga0075365_10032247
202 Ga0075365_10057047
203 Ga0075365_10175456
204 Ga0075363_100160905
205 Ga0075363_100333177
206 Ga0075367_10051572
207 Ga0097621_100469214
208 Ga0075428_100044017
209 Ga0075428_100580498
210 Ga0075428_101018657
211 Ga0075430_100000666
212 Ga0075430_100031972
213 Ga0075431_100000612
214 Ga0075431_100018952
215 Ga0075431_100043187
216 Ga0075431_100191746
217 Ga0075429_100000737
218 Ga0075429_100172300
219 Ga0075429_100182863
220 Ga0111539_10021614
221 Ga0111539_10073597
222 Ga0111539_11139917
223 Ga0105245_10423502
224 Ga0114129_10002421
225 Ga0114129_10125496
226 Ga0114129_10198451
227 Ga0105243_10753196
228 Ga0157373_10494816
229 Ga0157380_10290160
230 Ga0213873_10002490
231 Ga0224572_1011679
232 Ga0207707_10113394
233 Ga0207707_10463009
234 Ga0207644_10002939
235 Ga0207703_10101379
236 Ga0207702_10138669
237 Ga0207648_10704874
238 Ga0207675_100097308
239 Ga0207675_101241486
240 Ga0207428_10031038
241 Ga0207428_10133204
242 Ga0307408_100096763
243 Ga0307413_10157402
244 Ga0307407_10551859
245 Ga0307411_10463765
246 Ga0373928_0001303
247 Ga0373929_0004763
248 Ga0373932_0000378
249 Ga0373932_0178102
250 Ga0373931_0000010
251 Ga0373931_0000115
252 Ga0400483_103237
253 Ga0400483_127381
254 Ga0400483_215430
255 Ga0436365_1604231
256 Ga0436362_0562153
257 Ga0451853_0397199
258 Ga0439434_0004462
259 Ga0451577_0001613
260 Ga0453684_0001477
261 Ga0495629_0180538
262 Ga0495641_0262615
263 Ga0495653_0050545
264 Ga0495618_0384845
265 Ga0495628_0229856
266 Ga0495667_0067903
267 Ga0495635_0190152
268 Ga0495599_0376053
269 Ga0495658_0085508
270 Ga0495674_0364624
271 Ga0495680_0412232
272 Ga0495684_0049661
273 Ga0496111_0495227
274 Ga0496126_0248029
275 Ga0501031_0009118
276 Ga0501032_0030351
277 Ga0501032_0151497
278 Ga0501033_0000068
279 Ga0501034_0173807
280 Ga0501036_0004810
281 Ga0501036_0022520
282 Ga0501036_0273513
283 Ga0501036_0944649
284 Ga0501037_0078164
285 Ga0501037_0125949
286 Ga0501037_0395235
287 Ga0501038_0072995
288 Ga0501038_0104355
289 Ga0501039_0005821
290 Ga0501039_0133326
291 Ga0501039_0461076
292 Ga0501040_0077530
293 Ga0501041_0030626
294 Ga0501041_0036091
295 Ga0501041_0127376
296 Ga0501042_0608415
297 Ga0501046_0038885
298 Ga0501046_0752508
299 Ga0501047_0453303
300 Ga0501047_0454704
301 Ga0501048_0028246
302 Ga0501048_0138719
303 Ga0501067_0004988
304 Ga0501067_0036410
305 Ga0501068_0003267
306 Ga0501068_0294821
307 Ga0501069_0218282
308 Ga0501070_0000914
309 Ga0501070_0020281
310 Ga0501070_0121925
311 Ga0501070_0309422
312 Ga0501071_0034396
313 Ga0501071_0132455
314 Ga0501071_0144642
315 Ga0501071_0698361
316 Ga0501072_0003041
317 Ga0501072_0007329
318 Ga0501072_0009762
319 Ga0501072_0115146
320 Ga0501072_0378114
321 Ga0501073_0005251
322 Ga0501073_0119975
323 Ga0501074_0087438
324 Ga0501075_0005478
325 Ga0501075_0015554
326 Ga0501075_0032408
327 Ga0501076_0016149
328 Ga0501076_0134441
329 Ga0501077_0025156
330 Ga0501079_0014256
331 Ga0501079_0018586
332 Ga0501079_0751683
333 Ga0501080_0032295
334 Ga0501081_0005886
335 Ga0501081_0008972
336 Ga0501081_0271861
337 Ga0501083_0028225
338 Ga0501035_0194659
339 Ga0501044_0007743
340 Ga0501045_0008340
341 Ga0501045_0015644
342 Ga0501045_0025255
343 Ga0501045_0157718
344 nmdc:mga03n38_126841_c1
345 nmdc:mga0yw44_124940_c1
346 nmdc:mga0yw44_1790_c1
347 nmdc:mga06z11_60134_c1
348 nmdc:mga05p37_301192_c1
349 nmdc:mga05p37_667861_c1
350 nmdc:mga09592_211182_c1
351 nmdc:mga09592_291457_c1
352 nmdc:mga09592_380826_c1
353 nmdc:mga0qj67_10045_c1
354 nmdc:mga0qj67_108044_c1
355 nmdc:mga0qj67_60642_c1
356 nmdc:mga0qj67_820861_c1
357 nmdc:mga06r32_144_c1
358 nmdc:mga06r32_15760_c1
359 nmdc:mga06r32_269342_c1
360 nmdc:mga08y16_169512_c1
361 nmdc:mga08y16_711028_c1
362 nmdc:mga08y16_843505_c1
363 Ga0495595_0139246
364 Ga0495619_0195526
365 Ga0500566_0000935
366 Ga0500568_0048341
367 Ga0501084_0006842
368 Ga0501084_0028555
369 Ga0501082_0029897
370 Ga0501082_0030820
371 Ga0501082_0215893
372 Ga0501082_0304129
373 Ga0501082_0306372
374 Ga0501082_0695491
375 Ga0530510_0005695
376 Ga0530510_0013748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

41

216

0.9

PF01738

DLH

Dienelactone hydrolase family

80

206

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksr-assembly1.cif.gz_A-2 crystal structure of a putative serine hydrolase (xcc3885) from xanthomonas campestris pv. campestris at 2.69 a resolution 0.8061 1 186
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8052 2 185
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7965 2 183
6ikg-assembly1.cif.gz_A crystal structure of substrate-bound s9 peptidase (s514a mutant) from deinococcus radiodurans 0.7946 51 186
3ksr-assembly1.cif.gz_A-2 crystal structure of a putative serine hydrolase (xcc3885) from xanthomonas campestris pv. campestris at 2.69 a resolution 0.7942 1 186
ID Description Score Start End Superfamily
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.877 1 181 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8738 1 169 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8418 1 181 3.40.50.1820
af_I1LY02_58_317_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8223 3 186 3.40.50.1820
3ksrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8113 5 186 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6J7NAF8-F1-model_v4 Unannotated protein 0.9943 7 186
AF-A0A2E5FT81-F1-model_v4 Dienelactone hydrolase 0.9938 92 185 GO:0016787
AF-A0A7W1IA27-F1-model_v4 Dienelactone hydrolase 0.9928 22 157 GO:0016787
AF-A0A3S0DF76-F1-model_v4 Dienelactone hydrolase 0.9867 7 175 GO:0016787
AF-A0A6J6N7N8-F1-model_v4 Unannotated protein 0.9846 23 185

Map