F289798

General Info

Members Datasets Scaffolds Average Seq Length
188 118 188 356

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0071773|Ga0466959_0071773_180_1508
Length 407
Sequence MTDTTTIAGRYRIERRLGIGGMATVQLAFDQRLERYVAIKLLAEHLADDPAFVSRFRREALSAARLVHPNIVQVFDFGFDERQHQHFIVMEHVPGHSCAELLRDRGHLNVREGVEILAQACRGLDYAHRNGVVHRDVKPGNLLVSDTGVVKLADFGIARATDQSSITQVGSVLGTAAYLAPEQARGEPAGPRADLYSLGVVAYQLLSGRLPYEANSLSELALKQQRDSPPPLDQLNRGVTPELALAVALALSIDQTRRPPDAMALGETLRRGAAGLPPRATGATVIHGGRFDTGATRVVPDGRNGAGTDVTXXXXAAAEHAPTVPVPVQPSTPRRDAPAYGDDAYAGQARGYRDRPARSDRRAGAPAGGQAPTYPRTTALHLRHTFSSDWHTAVNQVRSLIGENTQK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 7.98
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 12.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100147916 3300005329 Bacteria 2227
2 Ga0068869_100049970 3300005334 Bacteria 3030
3 Ga0070682_100003538 3300005337 Bacteria 8644
4 Ga0068868_100006368 3300005338 Bacteria 8349
5 Ga0070660_100173820 3300005339 Bacteria 1741
6 Ga0070660_100232021 3300005339 Bacteria 1502
7 Ga0070691_10013933 3300005341 Bacteria 3690
8 Ga0070661_100180732 3300005344 Bacteria 1605
9 Ga0070675_100030052 3300005354 Bacteria 4384
10 Ga0070673_100274327 3300005364 Bacteria 1477
11 Ga0070688_100062751 3300005365 Bacteria 2353
12 Ga0070659_100000030 3300005366 Bacteria 128662
13 Ga0070714_100005051 3300005435 Bacteria 10037
14 Ga0070714_100017887 3300005435 Bacteria 5747
15 Ga0070714_100066113 3300005435 Bacteria 3116
16 Ga0070714_100215033 3300005435 Bacteria 1764
17 Ga0070710_10053719 3300005437 Bacteria 2271
18 Ga0070701_10075747 3300005438 Bacteria 1809
19 Ga0070705_100003324 3300005440 Bacteria 7892
20 Ga0070705_100046621 3300005440 Bacteria 2500
21 Ga0070700_100013184 3300005441 Bacteria 4637
22 Ga0070700_100122839 3300005441 Bacteria 1742
23 Ga0070663_100047461 3300005455 Bacteria 3042
24 Ga0070678_100026241 3300005456 Bacteria 3936
25 Ga0070678_100079221 3300005456 Bacteria 2484
26 Ga0070662_100070284 3300005457 Bacteria 2579
27 Ga0070684_100001766 3300005535 Bacteria 15773
28 Ga0070684_100180488 3300005535 Bacteria 1919
29 Ga0068853_100070580 3300005539 Bacteria 3041
30 Ga0070672_100217191 3300005543 Bacteria 1603
31 Ga0070664_100015011 3300005564 Bacteria 6323
32 Ga0068854_100211865 3300005578 Bacteria 1529
33 Ga0068856_100009596 3300005614 Bacteria 9402
34 Ga0068856_100020127 3300005614 Bacteria 6482
35 Ga0068859_100135208 3300005617 Bacteria 2538
36 Ga0068864_100003127 3300005618 Bacteria 13679
37 Ga0068866_10041940 3300005718 Bacteria 2274
38 Ga0081539_10006119 3300005985 Bacteria 11731
39 Ga0070717_10000013 3300006028 Bacteria 228046
40 Ga0070717_10013499 3300006028 Bacteria 6261
41 Ga0070717_10038496 3300006028 Bacteria 3888
42 Ga0070717_10075378 3300006028 Bacteria 2822
43 Ga0075428_100093097 3300006844 Bacteria 3285
44 Ga0075434_100043099 3300006871 Bacteria 4474
45 Ga0075429_100020086 3300006880 Bacteria 5793
46 Ga0068865_100175323 3300006881 Bacteria 1647
47 Ga0075436_100090457 3300006914 Bacteria 2128
48 Ga0097620_100135211 3300006931 Bacteria 2538
49 Ga0111539_10013770 3300009094 Bacteria 10102
50 Ga0111539_10146383 3300009094 Bacteria 2766
51 Ga0105245_10043846 3300009098 Bacteria 3991
52 Ga0114129_10058587 3300009147 Bacteria 5387
53 Ga0105243_10025140 3300009148 Bacteria 4548
54 Ga0105239_10220307 3300010375 Bacteria 2128
55 Ga0157375_10215218 3300013308 Bacteria 2079
56 Ga0157380_10216854 3300014326 Bacteria 1709
57 Ga0157380_10346130 3300014326 Bacteria 1389
58 Ga0157377_10009314 3300014745 Bacteria 4811
59 Ga0157376_10170108 3300014969 Bacteria 1983
60 Ga0213874_10000263 3300021377 Bacteria 10106
61 Ga0213876_10007298 3300021384 Bacteria 6018
62 Ga0213876_10016019 3300021384 Bacteria 3965
63 Ga0213876_10020368 3300021384 Bacteria 3505
64 Ga0213875_10000095 3300021388 Bacteria 102332
65 Ga0213875_10012685 3300021388 Bacteria 4150
66 Ga0207692_10000005 3300025898 Bacteria 370169
67 Ga0207692_10087180 3300025898 Bacteria 1684
68 Ga0207642_10018224 3300025899 Bacteria 2690
69 Ga0207688_10000574 3300025901 Bacteria 18050
70 Ga0207643_10073449 3300025908 Bacteria 1971
71 Ga0207693_10000028 3300025915 Bacteria 120041
72 Ga0207693_10090461 3300025915 Bacteria 2399
73 Ga0207657_10133154 3300025919 Bacteria 2036
74 Ga0207659_10023493 3300025926 Bacteria 4116
75 Ga0207687_10030866 3300025927 Bacteria 3617
76 Ga0207700_10185550 3300025928 Bacteria 1744
77 Ga0207664_10000060 3300025929 Bacteria 116764
78 Ga0207664_10001622 3300025929 Bacteria 14802
79 Ga0207690_10000094 3300025932 Bacteria 74114
80 Ga0207690_10147618 3300025932 Bacteria 1740
81 Ga0207706_10010294 3300025933 Bacteria 8551
82 Ga0207709_10033702 3300025935 Bacteria 3010
83 Ga0207669_10249657 3300025937 Bacteria 1320
84 Ga0207704_10050027 3300025938 Bacteria 2519
85 Ga0207691_10116618 3300025940 Bacteria 2370
86 Ga0207689_10026993 3300025942 Bacteria 4807
87 Ga0207640_10194945 3300025981 Bacteria 1530
88 Ga0207677_10032089 3300026023 Bacteria 3373
89 Ga0207677_10143908 3300026023 Bacteria 1829
90 Ga0207678_10095704 3300026067 Bacteria 2537
91 Ga0207708_10001896 3300026075 Bacteria 15450
92 Ga0207676_10123545 3300026095 Bacteria 2187
93 Ga0207675_100010874 3300026118 Bacteria 8524
94 Ga0207683_10031809 3300026121 Bacteria 4581
95 Ga0268265_10138672 3300028380 Bacteria 2033
96 Ga0265319_1000015 3300028563 Bacteria 176382
97 Ga0265334_10000151 3300028573 Bacteria 42917
98 Ga0265336_10000622 3300028666 Bacteria 19519
99 Ga0265338_10024213 3300028800 Bacteria 6210
100 Ga0265320_10011515 3300031240 Bacteria 5201
101 Ga0265320_10089109 3300031240 Bacteria 1431
102 Ga0307410_10261176 3300031852 Bacteria 1351
103 Ga0307416_100004052 3300032002 Bacteria 8756
104 Ga0395900_0008002 3300037418 Bacteria 10877
105 Ga0436364_0125472 3300037853 Bacteria 13181
106 Ga0436364_0287262 3300037853 Bacteria 10374
107 Ga0436364_0817554 3300037853 Bacteria 2977
108 Ga0436364_1056446 3300037853 Bacteria 11279
109 Ga0436364_1059319 3300037853 Bacteria 3677
110 Ga0436364_1269509 3300037853 Bacteria 4328
111 Ga0436364_1294613 3300037853 Bacteria 100298
112 Ga0436365_0210437 3300039437 Bacteria 7886
113 Ga0436365_0654648 3300039437 Bacteria 5627
114 Ga0436365_0656592 3300039437 Bacteria 8263
115 Ga0436365_0912124 3300039437 Bacteria 5815
116 Ga0436365_1002678 3300039437 Bacteria 16809
117 Ga0436365_1199389 3300039437 Bacteria 1613
118 Ga0436365_1429388 3300039437 Bacteria 4771
119 Ga0436365_1785439 3300039437 Bacteria 1898
120 Ga0436363_0365326 3300039450 Bacteria 16368
121 Ga0436363_0510790 3300039450 Bacteria 7648
122 Ga0439463_026256 3300042016 Bacteria 1463
123 Ga0466969_0047111 3300044656 Bacteria 2135
124 Ga0466966_0054649 3300044684 Bacteria 2530
125 Ga0466966_0093391 3300044684 Bacteria 1866
126 Ga0466961_0001354 3300044693 Bacteria 15106
127 Ga0466961_0007269 3300044693 Bacteria 7045
128 Ga0466963_0000273 3300044694 Bacteria 22985
129 Ga0466963_0001512 3300044694 Bacteria 12575
130 Ga0466963_0003004 3300044694 Bacteria 9545
131 Ga0466963_0010607 3300044694 Bacteria 5585
132 Ga0466963_0016710 3300044694 Bacteria 4566
133 Ga0466963_0021787 3300044694 Bacteria 4048
134 Ga0466963_0041530 3300044694 Bacteria 3017
135 Ga0466963_0045376 3300044694 Bacteria 2895
136 Ga0466963_0109311 3300044694 Bacteria 1897
137 Ga0466963_0162806 3300044694 Bacteria 1553
138 Ga0466963_0216883 3300044694 Bacteria 1339
139 Ga0466971_0001423 3300044719 Bacteria 10052
140 Ga0466971_0073076 3300044719 Bacteria 1558
141 Ga0466968_0006296 3300044735 Bacteria 4468
142 Ga0466970_0030338 3300044765 Bacteria 2851
143 Ga0466970_0037389 3300044765 Bacteria 2573
144 Ga0466970_0038940 3300044765 Bacteria 2523
145 Ga0466959_0004786 3300045049 Bacteria 9132
146 Ga0466959_0006088 3300045049 Bacteria 8327
147 Ga0466959_0016350 3300045049 Bacteria 5420
148 Ga0466959_0023017 3300045049 Bacteria 4608
149 Ga0466959_0052471 3300045049 Bacteria 2986
150 Ga0466959_0071773 3300045049 Bacteria 2507
151 Ga0466959_0105197 3300045049 Bacteria 2018
152 Ga0466958_0001164 3300045836 Bacteria 12224
153 Ga0466958_0002323 3300045836 Bacteria 9488
154 Ga0466958_0003716 3300045836 Bacteria 7970
155 Ga0466958_0010161 3300045836 Bacteria 5263
156 Ga0466958_0031113 3300045836 Bacteria 3172
157 Ga0466958_0127014 3300045836 Bacteria 1599
158 Ga0466967_0010037 3300045976 Bacteria 7075
159 Ga0466967_0012144 3300045976 Bacteria 6570
160 Ga0466967_0019491 3300045976 Bacteria 5455
161 Ga0466967_0023308 3300045976 Bacteria 5069
162 Ga0466967_0108392 3300045976 Bacteria 2548
163 Ga0495652_0077847 3300046529 Bacteria 2747
164 Ga0496101_0001372 3300048904 Bacteria 14597
165 Ga0496102_0067202 3300048905 Bacteria 3287
166 Ga0496104_0016956 3300048907 Bacteria 6625
167 Ga0496105_0045152 3300048908 Bacteria 3635
168 Ga0496106_0048044 3300048909 Bacteria 3213
169 Ga0496107_0037589 3300048910 Bacteria 3474
170 Ga0496108_0027960 3300048911 Bacteria 4663
171 Ga0496108_0224837 3300048911 Bacteria 1631
172 Ga0496109_0029158 3300048912 Bacteria 4941
173 Ga0496109_0052502 3300048912 Bacteria 3716
174 Ga0496109_0252762 3300048912 Bacteria 1660
175 Ga0496110_0011124 3300048913 Bacteria 7350
176 Ga0496111_0038048 3300048914 Bacteria 3445
177 Ga0496113_0015774 3300048916 Bacteria 5204
178 Ga0496115_0000075 3300048918 Bacteria 90155
179 Ga0501038_0122892 3300049574 Bacteria 2139
180 Ga0501072_0135118 3300049588 Bacteria 1966
181 Ga0501079_0067232 3300049741 Bacteria 2766
182 Ga0501045_0104062 3300049824 Bacteria 2103
183 nmdc:mga09592_17372_c1 3300050508 Bacteria 5894
184 nmdc:mga06r32_125804_c1 3300050510 Bacteria 2532
185 nmdc:mga08y16_82880_c1 3300050511 Bacteria 3343
186 Ga0500556_0000817 3300053104 Bacteria 17987
187 Ga0501084_0114154 3300054114 Bacteria 2271
188 Ga0466962_0021197 3300061719 Bacteria 3121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0000075 Ga0496115_0000075_33726_34937 315
2 3300050510 nmdc:mga06r32_125804_c1 nmdc:mga06r32_125804_c1_659_1894 316
3 3300021384 Ga0213876_10020368 Ga0213876_100203681 317
4 3300039437 Ga0436365_0654648 Ga0436365_0654648_3959_5206 317
5 3300025929 Ga0207664_10000060 Ga0207664_100000608 318
6 3300037853 Ga0436364_1056446 Ga0436364_1056446_576_1769 319
7 3300044735 Ga0466968_0006296 Ga0466968_0006296_1572_2804 319
8 3300044694 Ga0466963_0001512 Ga0466963_0001512_9412_10677 320
9 3300048911 Ga0496108_0224837 Ga0496108_0224837_24_1238 320
10 3300048912 Ga0496109_0029158 Ga0496109_0029158_1413_2627 320
11 3300028573 Ga0265334_10000151 Ga0265334_1000015134 321
12 3300028666 Ga0265336_10000622 Ga0265336_1000062217 321
13 3300028800 Ga0265338_10024213 Ga0265338_100242134 321
14 3300031240 Ga0265320_10089109 Ga0265320_100891092 321
15 3300006028 Ga0070717_10000013 Ga0070717_1000001350 323
16 3300025915 Ga0207693_10090461 Ga0207693_100904612 323
17 3300009094 Ga0111539_10013770 Ga0111539_100137702 325
18 3300021384 Ga0213876_10016019 Ga0213876_100160192 326
19 3300021388 Ga0213875_10012685 Ga0213875_100126852 326
20 3300032002 Ga0307416_100004052 Ga0307416_1000040525 326
21 3300037853 Ga0436364_0125472 Ga0436364_0125472_6974_8224 326
22 3300048912 Ga0496109_0252762 Ga0496109_0252762_230_1432 326
23 3300021388 Ga0213875_10000095 Ga0213875_1000009534 327
24 3300037853 Ga0436364_1294613 Ga0436364_1294613_67144_68436 327
25 3300045836 Ga0466958_0010161 Ga0466958_0010161_3790_4962 328
26 3300045976 Ga0466967_0012144 Ga0466967_0012144_3390_4562 328
27 3300053104 Ga0500556_0000817 Ga0500556_0000817_7046_8290 328
28 3300005339 Ga0070660_100232021 Ga0070660_1002320212 329
29 3300005366 Ga0070659_100000030 Ga0070659_10000003078 329
30 3300025919 Ga0207657_10133154 Ga0207657_101331542 329
31 3300025932 Ga0207690_10000094 Ga0207690_1000009461 329
32 3300005440 Ga0070705_100003324 Ga0070705_1000033243 330
33 3300037853 Ga0436364_0287262 Ga0436364_0287262_335_1534 330
34 3300039437 Ga0436365_0210437 Ga0436365_0210437_2782_3981 330
35 3300039450 Ga0436363_0510790 Ga0436363_0510790_5231_6430 330
36 3300039437 Ga0436365_1002678 Ga0436365_1002678_9226_10488 331
37 3300044694 Ga0466963_0109311 Ga0466963_0109311_664_1887 331
38 3300006028 Ga0070717_10075378 Ga0070717_100753783 332
39 3300006880 Ga0075429_100020086 Ga0075429_1000200863 332
40 3300025928 Ga0207700_10185550 Ga0207700_101855501 332
41 3300050508 nmdc:mga09592_17372_c1 nmdc:mga09592_17372_c1_1480_2673 332
42 3300061719 Ga0466962_0021197 Ga0466962_0021197_340_1581 332
43 3300005435 Ga0070714_100017887 Ga0070714_1000178876 333
44 3300006028 Ga0070717_10013499 Ga0070717_100134994 333
45 3300006844 Ga0075428_100093097 Ga0075428_1000930973 333
46 3300006871 Ga0075434_100043099 Ga0075434_1000430992 333
47 3300006914 Ga0075436_100090457 Ga0075436_1000904572 333
48 3300025929 Ga0207664_10001622 Ga0207664_100016224 333
49 3300028563 Ga0265319_1000015 Ga0265319_100001560 333
50 3300031240 Ga0265320_10011515 Ga0265320_100115153 333
51 3300005435 Ga0070714_100215033 Ga0070714_1002150331 334
52 3300005543 Ga0070672_100217191 Ga0070672_1002171912 334
53 3300009094 Ga0111539_10146383 Ga0111539_101463833 334
54 3300039437 Ga0436365_1429388 Ga0436365_1429388_3120_4400 334
55 3300045049 Ga0466959_0105197 Ga0466959_0105197_347_1588 334
56 3300009147 Ga0114129_10058587 Ga0114129_100585872 335
57 3300025898 Ga0207692_10000005 Ga0207692_10000005208 335
58 3300044656 Ga0466969_0047111 Ga0466969_0047111_732_1970 335
59 3300044694 Ga0466963_0003004 Ga0466963_0003004_5033_6271 335
60 3300044765 Ga0466970_0030338 Ga0466970_0030338_1372_2610 335
61 3300045049 Ga0466959_0006088 Ga0466959_0006088_2990_4228 335
62 3300045836 Ga0466958_0003716 Ga0466958_0003716_1687_2925 335
63 3300005334 Ga0068869_100049970 Ga0068869_1000499702 336
64 3300005337 Ga0070682_100003538 Ga0070682_1000035384 336
65 3300005338 Ga0068868_100006368 Ga0068868_1000063685 336
66 3300005341 Ga0070691_10013933 Ga0070691_100139333 336
67 3300005354 Ga0070675_100030052 Ga0070675_1000300524 336
68 3300005364 Ga0070673_100274327 Ga0070673_1002743271 336
69 3300005365 Ga0070688_100062751 Ga0070688_1000627513 336
70 3300005437 Ga0070710_10053719 Ga0070710_100537193 336
71 3300005440 Ga0070705_100046621 Ga0070705_1000466212 336
72 3300005441 Ga0070700_100013184 Ga0070700_1000131842 336
73 3300005455 Ga0070663_100047461 Ga0070663_1000474613 336
74 3300005456 Ga0070678_100079221 Ga0070678_1000792213 336
75 3300005457 Ga0070662_100070284 Ga0070662_1000702843 336
76 3300005535 Ga0070684_100001766 Ga0070684_1000017668 336
77 3300005539 Ga0068853_100070580 Ga0068853_1000705802 336
78 3300005564 Ga0070664_100015011 Ga0070664_1000150117 336
79 3300005614 Ga0068856_100020127 Ga0068856_1000201278 336
80 3300005617 Ga0068859_100135208 Ga0068859_1001352082 336
81 3300005618 Ga0068864_100003127 Ga0068864_1000031273 336
82 3300005718 Ga0068866_10041940 Ga0068866_100419403 336
83 3300006881 Ga0068865_100175323 Ga0068865_1001753232 336
84 3300006931 Ga0097620_100135211 Ga0097620_1001352112 336
85 3300009098 Ga0105245_10043846 Ga0105245_100438462 336
86 3300009148 Ga0105243_10025140 Ga0105243_100251403 336
87 3300013308 Ga0157375_10215218 Ga0157375_102152182 336
88 3300014326 Ga0157380_10346130 Ga0157380_103461302 336
89 3300014745 Ga0157377_10009314 Ga0157377_100093146 336
90 3300014969 Ga0157376_10170108 Ga0157376_101701082 336
91 3300025898 Ga0207692_10087180 Ga0207692_100871802 336
92 3300025899 Ga0207642_10018224 Ga0207642_100182242 336
93 3300025901 Ga0207688_10000574 Ga0207688_1000057415 336
94 3300025926 Ga0207659_10023493 Ga0207659_100234934 336
95 3300025927 Ga0207687_10030866 Ga0207687_100308664 336
96 3300025933 Ga0207706_10010294 Ga0207706_100102942 336
97 3300025935 Ga0207709_10033702 Ga0207709_100337023 336
98 3300025938 Ga0207704_10050027 Ga0207704_100500272 336
99 3300025942 Ga0207689_10026993 Ga0207689_100269933 336
100 3300026023 Ga0207677_10032089 Ga0207677_100320893 336
101 3300026067 Ga0207678_10095704 Ga0207678_100957042 336
102 3300026075 Ga0207708_10001896 Ga0207708_1000189618 336
103 3300026095 Ga0207676_10123545 Ga0207676_101235452 336
104 3300026118 Ga0207675_100010874 Ga0207675_1000108749 336
105 3300026121 Ga0207683_10031809 Ga0207683_100318094 336
106 3300028380 Ga0268265_10138672 Ga0268265_101386722 336
107 3300039437 Ga0436365_1199389 Ga0436365_1199389_157_1398 336
108 3300044693 Ga0466961_0001354 Ga0466961_0001354_10789_12036 336
109 3300048905 Ga0496102_0067202 Ga0496102_0067202_401_1627 336
110 3300048907 Ga0496104_0016956 Ga0496104_0016956_2087_3313 336
111 3300048908 Ga0496105_0045152 Ga0496105_0045152_1703_2929 336
112 3300048909 Ga0496106_0048044 Ga0496106_0048044_936_2162 336
113 3300048910 Ga0496107_0037589 Ga0496107_0037589_638_1864 336
114 3300048911 Ga0496108_0027960 Ga0496108_0027960_1663_2889 336
115 3300048912 Ga0496109_0052502 Ga0496109_0052502_628_1854 336
116 3300048913 Ga0496110_0011124 Ga0496110_0011124_584_1810 336
117 3300048914 Ga0496111_0038048 Ga0496111_0038048_264_1490 336
118 3300048916 Ga0496113_0015774 Ga0496113_0015774_1919_3145 336
119 3300045049 Ga0466959_0016350 Ga0466959_0016350_2352_3611 337
120 3300046529 Ga0495652_0077847 Ga0495652_0077847_982_2205 337
121 3300005344 Ga0070661_100180732 Ga0070661_1001807322 338
122 3300005578 Ga0068854_100211865 Ga0068854_1002118652 338
123 3300025981 Ga0207640_10194945 Ga0207640_101949452 338
124 3300045976 Ga0466967_0010037 Ga0466967_0010037_1291_2520 338
125 3300025915 Ga0207693_10000028 Ga0207693_1000002817 339
126 3300025940 Ga0207691_10116618 Ga0207691_101166182 339
127 3300026023 Ga0207677_10143908 Ga0207677_101439082 339
128 3300005435 Ga0070714_100005051 Ga0070714_1000050515 340
129 3300044694 Ga0466963_0016710 Ga0466963_0016710_2347_3612 340
130 3300005985 Ga0081539_10006119 Ga0081539_100061199 342
131 3300010375 Ga0105239_10220307 Ga0105239_102203072 342
132 3300045836 Ga0466958_0031113 Ga0466958_0031113_1102_2328 342
133 3300005435 Ga0070714_100066113 Ga0070714_1000661133 343
134 3300005614 Ga0068856_100009596 Ga0068856_1000095965 343
135 3300006028 Ga0070717_10038496 Ga0070717_100384964 343
136 3300044684 Ga0466966_0093391 Ga0466966_0093391_613_1845 343
137 3300044694 Ga0466963_0041530 Ga0466963_0041530_975_2207 343
138 3300044765 Ga0466970_0038940 Ga0466970_0038940_153_1385 343
139 3300021377 Ga0213874_10000263 Ga0213874_100002632 344
140 3300021384 Ga0213876_10007298 Ga0213876_100072987 344
141 3300039450 Ga0436363_0365326 Ga0436363_0365326_1813_3057 344
142 3300045049 Ga0466959_0004786 Ga0466959_0004786_817_2109 344
143 3300039437 Ga0436365_0656592 Ga0436365_0656592_4861_6114 345
144 3300044694 Ga0466963_0000273 Ga0466963_0000273_6529_7779 345
145 3300044719 Ga0466971_0073076 Ga0466971_0073076_140_1390 345
146 3300045836 Ga0466958_0001164 Ga0466958_0001164_10043_11293 345
147 3300045976 Ga0466967_0019491 Ga0466967_0019491_1987_3237 345
148 3300037853 Ga0436364_0817554 Ga0436364_0817554_1194_2453 346
149 3300039437 Ga0436365_0912124 Ga0436365_0912124_455_1714 346
150 3300045836 Ga0466958_0127014 Ga0466958_0127014_198_1442 347
151 3300005438 Ga0070701_10075747 Ga0070701_100757471 350
152 3300044684 Ga0466966_0054649 Ga0466966_0054649_816_2057 351
153 3300044693 Ga0466961_0007269 Ga0466961_0007269_4905_6146 351
154 3300044694 Ga0466963_0010607 Ga0466963_0010607_2270_3511 351
155 3300044719 Ga0466971_0001423 Ga0466971_0001423_7400_8641 351
156 3300044765 Ga0466970_0037389 Ga0466970_0037389_1192_2433 351
157 3300045049 Ga0466959_0023017 Ga0466959_0023017_1364_2605 351
158 3300045049 Ga0466959_0052471 Ga0466959_0052471_984_2285 351
159 3300045836 Ga0466958_0002323 Ga0466958_0002323_691_1932 351
160 3300005441 Ga0070700_100122839 Ga0070700_1001228392 352
161 3300037418 Ga0395900_0008002 Ga0395900_0008002_890_2176 352
162 3300005535 Ga0070684_100180488 Ga0070684_1001804883 353
163 3300039437 Ga0436365_1785439 Ga0436365_1785439_115_1365 353
164 3300044694 Ga0466963_0045376 Ga0466963_0045376_1358_2563 353
165 3300037853 Ga0436364_1269509 Ga0436364_1269509_613_1866 356
166 3300037853 Ga0436364_1059319 Ga0436364_1059319_1877_3142 357
167 3300045049 Ga0466959_0071773 Ga0466959_0071773_180_1508 358
168 3300048904 Ga0496101_0001372 Ga0496101_0001372_2272_3489 359
169 3300044694 Ga0466963_0162806 Ga0466963_0162806_303_1514 360
170 3300045976 Ga0466967_0108392 Ga0466967_0108392_1190_2401 360
171 3300049574 Ga0501038_0122892 Ga0501038_0122892_775_1962 361
172 3300049588 Ga0501072_0135118 Ga0501072_0135118_295_1482 361
173 3300049741 Ga0501079_0067232 Ga0501079_0067232_201_1388 361
174 3300049824 Ga0501045_0104062 Ga0501045_0104062_185_1372 361
175 3300054114 Ga0501084_0114154 Ga0501084_0114154_1027_2214 361
176 3300044694 Ga0466963_0021787 Ga0466963_0021787_1837_3039 363
177 3300045976 Ga0466967_0023308 Ga0466967_0023308_2983_4185 363
178 3300050511 nmdc:mga08y16_82880_c1 nmdc:mga08y16_82880_c1_742_1968 363
179 3300031852 Ga0307410_10261176 Ga0307410_102611762 364
180 3300042016 Ga0439463_026256 Ga0439463_026256_185_1417 365
181 3300014326 Ga0157380_10216854 Ga0157380_102168541 366
182 3300044694 Ga0466963_0216883 Ga0466963_0216883_96_1295 366
183 3300005339 Ga0070660_100173820 Ga0070660_1001738202 368
184 3300005456 Ga0070678_100026241 Ga0070678_1000262412 368
185 3300025908 Ga0207643_10073449 Ga0207643_100734492 368
186 3300025937 Ga0207669_10249657 Ga0207669_102496571 368
187 3300005329 Ga0070683_100147916 Ga0070683_1001479162 369
188 3300025932 Ga0207690_10147618 Ga0207690_101476182 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00069

Pkinase

Protein kinase domain

11

260

0.9

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

11

261

0.86

PF03109

ABC1

ABC1 atypical kinase-like domain

52

180

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b2p-assembly1.cif.gz_A-2 dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis 0.9517 7 273
1o6y-assembly1.cif.gz_A catalytic domain of pknb kinase from mycobacterium tuberculosis 0.9512 4 274
2fum-assembly3.cif.gz_C catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone 0.95 4 274
5u94-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693. 0.9499 8 273
6b2q-assembly1.cif.gz_D dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis 0.9443 6 279
ID Description Score Start End Superfamily
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9428 95 273 1.10.510.10
4eqmD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9361 95 274 1.10.510.10
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9317 95 273 1.10.510.10
af_P9WI77_97_289_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9284 95 274 1.10.510.10
af_Q86AE1_27_112_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9091 6 95 3.30.200.20

Feature Viewer

pLDDT pTM Quality
76.34 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map