F289798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 188 | 118 | 188 | 356 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0071773|Ga0466959_0071773_180_1508 |
| Length | 407 |
| Sequence | MTDTTTIAGRYRIERRLGIGGMATVQLAFDQRLERYVAIKLLAEHLADDPAFVSRFRREALSAARLVHPNIVQVFDFGFDERQHQHFIVMEHVPGHSCAELLRDRGHLNVREGVEILAQACRGLDYAHRNGVVHRDVKPGNLLVSDTGVVKLADFGIARATDQSSITQVGSVLGTAAYLAPEQARGEPAGPRADLYSLGVVAYQLLSGRLPYEANSLSELALKQQRDSPPPLDQLNRGVTPELALAVALALSIDQTRRPPDAMALGETLRRGAAGLPPRATGATVIHGGRFDTGATRVVPDGRNGAGTDVTXXXXAAAEHAPTVPVPVQPSTPRRDAPAYGDDAYAGQARGYRDRPARSDRRAGAPAGGQAPTYPRTTALHLRHTFSSDWHTAVNQVRSLIGENTQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 47 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 48 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 49 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 77 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 79 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 80 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 83 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 84 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 85 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 86 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 87 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 88 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 89 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 90 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 91 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 92 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 93 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 94 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 95 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 96 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 99 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 100 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 101 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 102 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 103 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 104 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 106 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 107 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 108 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 109 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 117 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 7.98 |
| Rhizosphere | 79.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100147916 | 3300005329 | Bacteria | 2227 |
| 2 | Ga0068869_100049970 | 3300005334 | Bacteria | 3030 |
| 3 | Ga0070682_100003538 | 3300005337 | Bacteria | 8644 |
| 4 | Ga0068868_100006368 | 3300005338 | Bacteria | 8349 |
| 5 | Ga0070660_100173820 | 3300005339 | Bacteria | 1741 |
| 6 | Ga0070660_100232021 | 3300005339 | Bacteria | 1502 |
| 7 | Ga0070691_10013933 | 3300005341 | Bacteria | 3690 |
| 8 | Ga0070661_100180732 | 3300005344 | Bacteria | 1605 |
| 9 | Ga0070675_100030052 | 3300005354 | Bacteria | 4384 |
| 10 | Ga0070673_100274327 | 3300005364 | Bacteria | 1477 |
| 11 | Ga0070688_100062751 | 3300005365 | Bacteria | 2353 |
| 12 | Ga0070659_100000030 | 3300005366 | Bacteria | 128662 |
| 13 | Ga0070714_100005051 | 3300005435 | Bacteria | 10037 |
| 14 | Ga0070714_100017887 | 3300005435 | Bacteria | 5747 |
| 15 | Ga0070714_100066113 | 3300005435 | Bacteria | 3116 |
| 16 | Ga0070714_100215033 | 3300005435 | Bacteria | 1764 |
| 17 | Ga0070710_10053719 | 3300005437 | Bacteria | 2271 |
| 18 | Ga0070701_10075747 | 3300005438 | Bacteria | 1809 |
| 19 | Ga0070705_100003324 | 3300005440 | Bacteria | 7892 |
| 20 | Ga0070705_100046621 | 3300005440 | Bacteria | 2500 |
| 21 | Ga0070700_100013184 | 3300005441 | Bacteria | 4637 |
| 22 | Ga0070700_100122839 | 3300005441 | Bacteria | 1742 |
| 23 | Ga0070663_100047461 | 3300005455 | Bacteria | 3042 |
| 24 | Ga0070678_100026241 | 3300005456 | Bacteria | 3936 |
| 25 | Ga0070678_100079221 | 3300005456 | Bacteria | 2484 |
| 26 | Ga0070662_100070284 | 3300005457 | Bacteria | 2579 |
| 27 | Ga0070684_100001766 | 3300005535 | Bacteria | 15773 |
| 28 | Ga0070684_100180488 | 3300005535 | Bacteria | 1919 |
| 29 | Ga0068853_100070580 | 3300005539 | Bacteria | 3041 |
| 30 | Ga0070672_100217191 | 3300005543 | Bacteria | 1603 |
| 31 | Ga0070664_100015011 | 3300005564 | Bacteria | 6323 |
| 32 | Ga0068854_100211865 | 3300005578 | Bacteria | 1529 |
| 33 | Ga0068856_100009596 | 3300005614 | Bacteria | 9402 |
| 34 | Ga0068856_100020127 | 3300005614 | Bacteria | 6482 |
| 35 | Ga0068859_100135208 | 3300005617 | Bacteria | 2538 |
| 36 | Ga0068864_100003127 | 3300005618 | Bacteria | 13679 |
| 37 | Ga0068866_10041940 | 3300005718 | Bacteria | 2274 |
| 38 | Ga0081539_10006119 | 3300005985 | Bacteria | 11731 |
| 39 | Ga0070717_10000013 | 3300006028 | Bacteria | 228046 |
| 40 | Ga0070717_10013499 | 3300006028 | Bacteria | 6261 |
| 41 | Ga0070717_10038496 | 3300006028 | Bacteria | 3888 |
| 42 | Ga0070717_10075378 | 3300006028 | Bacteria | 2822 |
| 43 | Ga0075428_100093097 | 3300006844 | Bacteria | 3285 |
| 44 | Ga0075434_100043099 | 3300006871 | Bacteria | 4474 |
| 45 | Ga0075429_100020086 | 3300006880 | Bacteria | 5793 |
| 46 | Ga0068865_100175323 | 3300006881 | Bacteria | 1647 |
| 47 | Ga0075436_100090457 | 3300006914 | Bacteria | 2128 |
| 48 | Ga0097620_100135211 | 3300006931 | Bacteria | 2538 |
| 49 | Ga0111539_10013770 | 3300009094 | Bacteria | 10102 |
| 50 | Ga0111539_10146383 | 3300009094 | Bacteria | 2766 |
| 51 | Ga0105245_10043846 | 3300009098 | Bacteria | 3991 |
| 52 | Ga0114129_10058587 | 3300009147 | Bacteria | 5387 |
| 53 | Ga0105243_10025140 | 3300009148 | Bacteria | 4548 |
| 54 | Ga0105239_10220307 | 3300010375 | Bacteria | 2128 |
| 55 | Ga0157375_10215218 | 3300013308 | Bacteria | 2079 |
| 56 | Ga0157380_10216854 | 3300014326 | Bacteria | 1709 |
| 57 | Ga0157380_10346130 | 3300014326 | Bacteria | 1389 |
| 58 | Ga0157377_10009314 | 3300014745 | Bacteria | 4811 |
| 59 | Ga0157376_10170108 | 3300014969 | Bacteria | 1983 |
| 60 | Ga0213874_10000263 | 3300021377 | Bacteria | 10106 |
| 61 | Ga0213876_10007298 | 3300021384 | Bacteria | 6018 |
| 62 | Ga0213876_10016019 | 3300021384 | Bacteria | 3965 |
| 63 | Ga0213876_10020368 | 3300021384 | Bacteria | 3505 |
| 64 | Ga0213875_10000095 | 3300021388 | Bacteria | 102332 |
| 65 | Ga0213875_10012685 | 3300021388 | Bacteria | 4150 |
| 66 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 67 | Ga0207692_10087180 | 3300025898 | Bacteria | 1684 |
| 68 | Ga0207642_10018224 | 3300025899 | Bacteria | 2690 |
| 69 | Ga0207688_10000574 | 3300025901 | Bacteria | 18050 |
| 70 | Ga0207643_10073449 | 3300025908 | Bacteria | 1971 |
| 71 | Ga0207693_10000028 | 3300025915 | Bacteria | 120041 |
| 72 | Ga0207693_10090461 | 3300025915 | Bacteria | 2399 |
| 73 | Ga0207657_10133154 | 3300025919 | Bacteria | 2036 |
| 74 | Ga0207659_10023493 | 3300025926 | Bacteria | 4116 |
| 75 | Ga0207687_10030866 | 3300025927 | Bacteria | 3617 |
| 76 | Ga0207700_10185550 | 3300025928 | Bacteria | 1744 |
| 77 | Ga0207664_10000060 | 3300025929 | Bacteria | 116764 |
| 78 | Ga0207664_10001622 | 3300025929 | Bacteria | 14802 |
| 79 | Ga0207690_10000094 | 3300025932 | Bacteria | 74114 |
| 80 | Ga0207690_10147618 | 3300025932 | Bacteria | 1740 |
| 81 | Ga0207706_10010294 | 3300025933 | Bacteria | 8551 |
| 82 | Ga0207709_10033702 | 3300025935 | Bacteria | 3010 |
| 83 | Ga0207669_10249657 | 3300025937 | Bacteria | 1320 |
| 84 | Ga0207704_10050027 | 3300025938 | Bacteria | 2519 |
| 85 | Ga0207691_10116618 | 3300025940 | Bacteria | 2370 |
| 86 | Ga0207689_10026993 | 3300025942 | Bacteria | 4807 |
| 87 | Ga0207640_10194945 | 3300025981 | Bacteria | 1530 |
| 88 | Ga0207677_10032089 | 3300026023 | Bacteria | 3373 |
| 89 | Ga0207677_10143908 | 3300026023 | Bacteria | 1829 |
| 90 | Ga0207678_10095704 | 3300026067 | Bacteria | 2537 |
| 91 | Ga0207708_10001896 | 3300026075 | Bacteria | 15450 |
| 92 | Ga0207676_10123545 | 3300026095 | Bacteria | 2187 |
| 93 | Ga0207675_100010874 | 3300026118 | Bacteria | 8524 |
| 94 | Ga0207683_10031809 | 3300026121 | Bacteria | 4581 |
| 95 | Ga0268265_10138672 | 3300028380 | Bacteria | 2033 |
| 96 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 97 | Ga0265334_10000151 | 3300028573 | Bacteria | 42917 |
| 98 | Ga0265336_10000622 | 3300028666 | Bacteria | 19519 |
| 99 | Ga0265338_10024213 | 3300028800 | Bacteria | 6210 |
| 100 | Ga0265320_10011515 | 3300031240 | Bacteria | 5201 |
| 101 | Ga0265320_10089109 | 3300031240 | Bacteria | 1431 |
| 102 | Ga0307410_10261176 | 3300031852 | Bacteria | 1351 |
| 103 | Ga0307416_100004052 | 3300032002 | Bacteria | 8756 |
| 104 | Ga0395900_0008002 | 3300037418 | Bacteria | 10877 |
| 105 | Ga0436364_0125472 | 3300037853 | Bacteria | 13181 |
| 106 | Ga0436364_0287262 | 3300037853 | Bacteria | 10374 |
| 107 | Ga0436364_0817554 | 3300037853 | Bacteria | 2977 |
| 108 | Ga0436364_1056446 | 3300037853 | Bacteria | 11279 |
| 109 | Ga0436364_1059319 | 3300037853 | Bacteria | 3677 |
| 110 | Ga0436364_1269509 | 3300037853 | Bacteria | 4328 |
| 111 | Ga0436364_1294613 | 3300037853 | Bacteria | 100298 |
| 112 | Ga0436365_0210437 | 3300039437 | Bacteria | 7886 |
| 113 | Ga0436365_0654648 | 3300039437 | Bacteria | 5627 |
| 114 | Ga0436365_0656592 | 3300039437 | Bacteria | 8263 |
| 115 | Ga0436365_0912124 | 3300039437 | Bacteria | 5815 |
| 116 | Ga0436365_1002678 | 3300039437 | Bacteria | 16809 |
| 117 | Ga0436365_1199389 | 3300039437 | Bacteria | 1613 |
| 118 | Ga0436365_1429388 | 3300039437 | Bacteria | 4771 |
| 119 | Ga0436365_1785439 | 3300039437 | Bacteria | 1898 |
| 120 | Ga0436363_0365326 | 3300039450 | Bacteria | 16368 |
| 121 | Ga0436363_0510790 | 3300039450 | Bacteria | 7648 |
| 122 | Ga0439463_026256 | 3300042016 | Bacteria | 1463 |
| 123 | Ga0466969_0047111 | 3300044656 | Bacteria | 2135 |
| 124 | Ga0466966_0054649 | 3300044684 | Bacteria | 2530 |
| 125 | Ga0466966_0093391 | 3300044684 | Bacteria | 1866 |
| 126 | Ga0466961_0001354 | 3300044693 | Bacteria | 15106 |
| 127 | Ga0466961_0007269 | 3300044693 | Bacteria | 7045 |
| 128 | Ga0466963_0000273 | 3300044694 | Bacteria | 22985 |
| 129 | Ga0466963_0001512 | 3300044694 | Bacteria | 12575 |
| 130 | Ga0466963_0003004 | 3300044694 | Bacteria | 9545 |
| 131 | Ga0466963_0010607 | 3300044694 | Bacteria | 5585 |
| 132 | Ga0466963_0016710 | 3300044694 | Bacteria | 4566 |
| 133 | Ga0466963_0021787 | 3300044694 | Bacteria | 4048 |
| 134 | Ga0466963_0041530 | 3300044694 | Bacteria | 3017 |
| 135 | Ga0466963_0045376 | 3300044694 | Bacteria | 2895 |
| 136 | Ga0466963_0109311 | 3300044694 | Bacteria | 1897 |
| 137 | Ga0466963_0162806 | 3300044694 | Bacteria | 1553 |
| 138 | Ga0466963_0216883 | 3300044694 | Bacteria | 1339 |
| 139 | Ga0466971_0001423 | 3300044719 | Bacteria | 10052 |
| 140 | Ga0466971_0073076 | 3300044719 | Bacteria | 1558 |
| 141 | Ga0466968_0006296 | 3300044735 | Bacteria | 4468 |
| 142 | Ga0466970_0030338 | 3300044765 | Bacteria | 2851 |
| 143 | Ga0466970_0037389 | 3300044765 | Bacteria | 2573 |
| 144 | Ga0466970_0038940 | 3300044765 | Bacteria | 2523 |
| 145 | Ga0466959_0004786 | 3300045049 | Bacteria | 9132 |
| 146 | Ga0466959_0006088 | 3300045049 | Bacteria | 8327 |
| 147 | Ga0466959_0016350 | 3300045049 | Bacteria | 5420 |
| 148 | Ga0466959_0023017 | 3300045049 | Bacteria | 4608 |
| 149 | Ga0466959_0052471 | 3300045049 | Bacteria | 2986 |
| 150 | Ga0466959_0071773 | 3300045049 | Bacteria | 2507 |
| 151 | Ga0466959_0105197 | 3300045049 | Bacteria | 2018 |
| 152 | Ga0466958_0001164 | 3300045836 | Bacteria | 12224 |
| 153 | Ga0466958_0002323 | 3300045836 | Bacteria | 9488 |
| 154 | Ga0466958_0003716 | 3300045836 | Bacteria | 7970 |
| 155 | Ga0466958_0010161 | 3300045836 | Bacteria | 5263 |
| 156 | Ga0466958_0031113 | 3300045836 | Bacteria | 3172 |
| 157 | Ga0466958_0127014 | 3300045836 | Bacteria | 1599 |
| 158 | Ga0466967_0010037 | 3300045976 | Bacteria | 7075 |
| 159 | Ga0466967_0012144 | 3300045976 | Bacteria | 6570 |
| 160 | Ga0466967_0019491 | 3300045976 | Bacteria | 5455 |
| 161 | Ga0466967_0023308 | 3300045976 | Bacteria | 5069 |
| 162 | Ga0466967_0108392 | 3300045976 | Bacteria | 2548 |
| 163 | Ga0495652_0077847 | 3300046529 | Bacteria | 2747 |
| 164 | Ga0496101_0001372 | 3300048904 | Bacteria | 14597 |
| 165 | Ga0496102_0067202 | 3300048905 | Bacteria | 3287 |
| 166 | Ga0496104_0016956 | 3300048907 | Bacteria | 6625 |
| 167 | Ga0496105_0045152 | 3300048908 | Bacteria | 3635 |
| 168 | Ga0496106_0048044 | 3300048909 | Bacteria | 3213 |
| 169 | Ga0496107_0037589 | 3300048910 | Bacteria | 3474 |
| 170 | Ga0496108_0027960 | 3300048911 | Bacteria | 4663 |
| 171 | Ga0496108_0224837 | 3300048911 | Bacteria | 1631 |
| 172 | Ga0496109_0029158 | 3300048912 | Bacteria | 4941 |
| 173 | Ga0496109_0052502 | 3300048912 | Bacteria | 3716 |
| 174 | Ga0496109_0252762 | 3300048912 | Bacteria | 1660 |
| 175 | Ga0496110_0011124 | 3300048913 | Bacteria | 7350 |
| 176 | Ga0496111_0038048 | 3300048914 | Bacteria | 3445 |
| 177 | Ga0496113_0015774 | 3300048916 | Bacteria | 5204 |
| 178 | Ga0496115_0000075 | 3300048918 | Bacteria | 90155 |
| 179 | Ga0501038_0122892 | 3300049574 | Bacteria | 2139 |
| 180 | Ga0501072_0135118 | 3300049588 | Bacteria | 1966 |
| 181 | Ga0501079_0067232 | 3300049741 | Bacteria | 2766 |
| 182 | Ga0501045_0104062 | 3300049824 | Bacteria | 2103 |
| 183 | nmdc:mga09592_17372_c1 | 3300050508 | Bacteria | 5894 |
| 184 | nmdc:mga06r32_125804_c1 | 3300050510 | Bacteria | 2532 |
| 185 | nmdc:mga08y16_82880_c1 | 3300050511 | Bacteria | 3343 |
| 186 | Ga0500556_0000817 | 3300053104 | Bacteria | 17987 |
| 187 | Ga0501084_0114154 | 3300054114 | Bacteria | 2271 |
| 188 | Ga0466962_0021197 | 3300061719 | Bacteria | 3121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0000075 | Ga0496115_0000075_33726_34937 | 315 |
| 2 | 3300050510 | nmdc:mga06r32_125804_c1 | nmdc:mga06r32_125804_c1_659_1894 | 316 |
| 3 | 3300021384 | Ga0213876_10020368 | Ga0213876_100203681 | 317 |
| 4 | 3300039437 | Ga0436365_0654648 | Ga0436365_0654648_3959_5206 | 317 |
| 5 | 3300025929 | Ga0207664_10000060 | Ga0207664_100000608 | 318 |
| 6 | 3300037853 | Ga0436364_1056446 | Ga0436364_1056446_576_1769 | 319 |
| 7 | 3300044735 | Ga0466968_0006296 | Ga0466968_0006296_1572_2804 | 319 |
| 8 | 3300044694 | Ga0466963_0001512 | Ga0466963_0001512_9412_10677 | 320 |
| 9 | 3300048911 | Ga0496108_0224837 | Ga0496108_0224837_24_1238 | 320 |
| 10 | 3300048912 | Ga0496109_0029158 | Ga0496109_0029158_1413_2627 | 320 |
| 11 | 3300028573 | Ga0265334_10000151 | Ga0265334_1000015134 | 321 |
| 12 | 3300028666 | Ga0265336_10000622 | Ga0265336_1000062217 | 321 |
| 13 | 3300028800 | Ga0265338_10024213 | Ga0265338_100242134 | 321 |
| 14 | 3300031240 | Ga0265320_10089109 | Ga0265320_100891092 | 321 |
| 15 | 3300006028 | Ga0070717_10000013 | Ga0070717_1000001350 | 323 |
| 16 | 3300025915 | Ga0207693_10090461 | Ga0207693_100904612 | 323 |
| 17 | 3300009094 | Ga0111539_10013770 | Ga0111539_100137702 | 325 |
| 18 | 3300021384 | Ga0213876_10016019 | Ga0213876_100160192 | 326 |
| 19 | 3300021388 | Ga0213875_10012685 | Ga0213875_100126852 | 326 |
| 20 | 3300032002 | Ga0307416_100004052 | Ga0307416_1000040525 | 326 |
| 21 | 3300037853 | Ga0436364_0125472 | Ga0436364_0125472_6974_8224 | 326 |
| 22 | 3300048912 | Ga0496109_0252762 | Ga0496109_0252762_230_1432 | 326 |
| 23 | 3300021388 | Ga0213875_10000095 | Ga0213875_1000009534 | 327 |
| 24 | 3300037853 | Ga0436364_1294613 | Ga0436364_1294613_67144_68436 | 327 |
| 25 | 3300045836 | Ga0466958_0010161 | Ga0466958_0010161_3790_4962 | 328 |
| 26 | 3300045976 | Ga0466967_0012144 | Ga0466967_0012144_3390_4562 | 328 |
| 27 | 3300053104 | Ga0500556_0000817 | Ga0500556_0000817_7046_8290 | 328 |
| 28 | 3300005339 | Ga0070660_100232021 | Ga0070660_1002320212 | 329 |
| 29 | 3300005366 | Ga0070659_100000030 | Ga0070659_10000003078 | 329 |
| 30 | 3300025919 | Ga0207657_10133154 | Ga0207657_101331542 | 329 |
| 31 | 3300025932 | Ga0207690_10000094 | Ga0207690_1000009461 | 329 |
| 32 | 3300005440 | Ga0070705_100003324 | Ga0070705_1000033243 | 330 |
| 33 | 3300037853 | Ga0436364_0287262 | Ga0436364_0287262_335_1534 | 330 |
| 34 | 3300039437 | Ga0436365_0210437 | Ga0436365_0210437_2782_3981 | 330 |
| 35 | 3300039450 | Ga0436363_0510790 | Ga0436363_0510790_5231_6430 | 330 |
| 36 | 3300039437 | Ga0436365_1002678 | Ga0436365_1002678_9226_10488 | 331 |
| 37 | 3300044694 | Ga0466963_0109311 | Ga0466963_0109311_664_1887 | 331 |
| 38 | 3300006028 | Ga0070717_10075378 | Ga0070717_100753783 | 332 |
| 39 | 3300006880 | Ga0075429_100020086 | Ga0075429_1000200863 | 332 |
| 40 | 3300025928 | Ga0207700_10185550 | Ga0207700_101855501 | 332 |
| 41 | 3300050508 | nmdc:mga09592_17372_c1 | nmdc:mga09592_17372_c1_1480_2673 | 332 |
| 42 | 3300061719 | Ga0466962_0021197 | Ga0466962_0021197_340_1581 | 332 |
| 43 | 3300005435 | Ga0070714_100017887 | Ga0070714_1000178876 | 333 |
| 44 | 3300006028 | Ga0070717_10013499 | Ga0070717_100134994 | 333 |
| 45 | 3300006844 | Ga0075428_100093097 | Ga0075428_1000930973 | 333 |
| 46 | 3300006871 | Ga0075434_100043099 | Ga0075434_1000430992 | 333 |
| 47 | 3300006914 | Ga0075436_100090457 | Ga0075436_1000904572 | 333 |
| 48 | 3300025929 | Ga0207664_10001622 | Ga0207664_100016224 | 333 |
| 49 | 3300028563 | Ga0265319_1000015 | Ga0265319_100001560 | 333 |
| 50 | 3300031240 | Ga0265320_10011515 | Ga0265320_100115153 | 333 |
| 51 | 3300005435 | Ga0070714_100215033 | Ga0070714_1002150331 | 334 |
| 52 | 3300005543 | Ga0070672_100217191 | Ga0070672_1002171912 | 334 |
| 53 | 3300009094 | Ga0111539_10146383 | Ga0111539_101463833 | 334 |
| 54 | 3300039437 | Ga0436365_1429388 | Ga0436365_1429388_3120_4400 | 334 |
| 55 | 3300045049 | Ga0466959_0105197 | Ga0466959_0105197_347_1588 | 334 |
| 56 | 3300009147 | Ga0114129_10058587 | Ga0114129_100585872 | 335 |
| 57 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005208 | 335 |
| 58 | 3300044656 | Ga0466969_0047111 | Ga0466969_0047111_732_1970 | 335 |
| 59 | 3300044694 | Ga0466963_0003004 | Ga0466963_0003004_5033_6271 | 335 |
| 60 | 3300044765 | Ga0466970_0030338 | Ga0466970_0030338_1372_2610 | 335 |
| 61 | 3300045049 | Ga0466959_0006088 | Ga0466959_0006088_2990_4228 | 335 |
| 62 | 3300045836 | Ga0466958_0003716 | Ga0466958_0003716_1687_2925 | 335 |
| 63 | 3300005334 | Ga0068869_100049970 | Ga0068869_1000499702 | 336 |
| 64 | 3300005337 | Ga0070682_100003538 | Ga0070682_1000035384 | 336 |
| 65 | 3300005338 | Ga0068868_100006368 | Ga0068868_1000063685 | 336 |
| 66 | 3300005341 | Ga0070691_10013933 | Ga0070691_100139333 | 336 |
| 67 | 3300005354 | Ga0070675_100030052 | Ga0070675_1000300524 | 336 |
| 68 | 3300005364 | Ga0070673_100274327 | Ga0070673_1002743271 | 336 |
| 69 | 3300005365 | Ga0070688_100062751 | Ga0070688_1000627513 | 336 |
| 70 | 3300005437 | Ga0070710_10053719 | Ga0070710_100537193 | 336 |
| 71 | 3300005440 | Ga0070705_100046621 | Ga0070705_1000466212 | 336 |
| 72 | 3300005441 | Ga0070700_100013184 | Ga0070700_1000131842 | 336 |
| 73 | 3300005455 | Ga0070663_100047461 | Ga0070663_1000474613 | 336 |
| 74 | 3300005456 | Ga0070678_100079221 | Ga0070678_1000792213 | 336 |
| 75 | 3300005457 | Ga0070662_100070284 | Ga0070662_1000702843 | 336 |
| 76 | 3300005535 | Ga0070684_100001766 | Ga0070684_1000017668 | 336 |
| 77 | 3300005539 | Ga0068853_100070580 | Ga0068853_1000705802 | 336 |
| 78 | 3300005564 | Ga0070664_100015011 | Ga0070664_1000150117 | 336 |
| 79 | 3300005614 | Ga0068856_100020127 | Ga0068856_1000201278 | 336 |
| 80 | 3300005617 | Ga0068859_100135208 | Ga0068859_1001352082 | 336 |
| 81 | 3300005618 | Ga0068864_100003127 | Ga0068864_1000031273 | 336 |
| 82 | 3300005718 | Ga0068866_10041940 | Ga0068866_100419403 | 336 |
| 83 | 3300006881 | Ga0068865_100175323 | Ga0068865_1001753232 | 336 |
| 84 | 3300006931 | Ga0097620_100135211 | Ga0097620_1001352112 | 336 |
| 85 | 3300009098 | Ga0105245_10043846 | Ga0105245_100438462 | 336 |
| 86 | 3300009148 | Ga0105243_10025140 | Ga0105243_100251403 | 336 |
| 87 | 3300013308 | Ga0157375_10215218 | Ga0157375_102152182 | 336 |
| 88 | 3300014326 | Ga0157380_10346130 | Ga0157380_103461302 | 336 |
| 89 | 3300014745 | Ga0157377_10009314 | Ga0157377_100093146 | 336 |
| 90 | 3300014969 | Ga0157376_10170108 | Ga0157376_101701082 | 336 |
| 91 | 3300025898 | Ga0207692_10087180 | Ga0207692_100871802 | 336 |
| 92 | 3300025899 | Ga0207642_10018224 | Ga0207642_100182242 | 336 |
| 93 | 3300025901 | Ga0207688_10000574 | Ga0207688_1000057415 | 336 |
| 94 | 3300025926 | Ga0207659_10023493 | Ga0207659_100234934 | 336 |
| 95 | 3300025927 | Ga0207687_10030866 | Ga0207687_100308664 | 336 |
| 96 | 3300025933 | Ga0207706_10010294 | Ga0207706_100102942 | 336 |
| 97 | 3300025935 | Ga0207709_10033702 | Ga0207709_100337023 | 336 |
| 98 | 3300025938 | Ga0207704_10050027 | Ga0207704_100500272 | 336 |
| 99 | 3300025942 | Ga0207689_10026993 | Ga0207689_100269933 | 336 |
| 100 | 3300026023 | Ga0207677_10032089 | Ga0207677_100320893 | 336 |
| 101 | 3300026067 | Ga0207678_10095704 | Ga0207678_100957042 | 336 |
| 102 | 3300026075 | Ga0207708_10001896 | Ga0207708_1000189618 | 336 |
| 103 | 3300026095 | Ga0207676_10123545 | Ga0207676_101235452 | 336 |
| 104 | 3300026118 | Ga0207675_100010874 | Ga0207675_1000108749 | 336 |
| 105 | 3300026121 | Ga0207683_10031809 | Ga0207683_100318094 | 336 |
| 106 | 3300028380 | Ga0268265_10138672 | Ga0268265_101386722 | 336 |
| 107 | 3300039437 | Ga0436365_1199389 | Ga0436365_1199389_157_1398 | 336 |
| 108 | 3300044693 | Ga0466961_0001354 | Ga0466961_0001354_10789_12036 | 336 |
| 109 | 3300048905 | Ga0496102_0067202 | Ga0496102_0067202_401_1627 | 336 |
| 110 | 3300048907 | Ga0496104_0016956 | Ga0496104_0016956_2087_3313 | 336 |
| 111 | 3300048908 | Ga0496105_0045152 | Ga0496105_0045152_1703_2929 | 336 |
| 112 | 3300048909 | Ga0496106_0048044 | Ga0496106_0048044_936_2162 | 336 |
| 113 | 3300048910 | Ga0496107_0037589 | Ga0496107_0037589_638_1864 | 336 |
| 114 | 3300048911 | Ga0496108_0027960 | Ga0496108_0027960_1663_2889 | 336 |
| 115 | 3300048912 | Ga0496109_0052502 | Ga0496109_0052502_628_1854 | 336 |
| 116 | 3300048913 | Ga0496110_0011124 | Ga0496110_0011124_584_1810 | 336 |
| 117 | 3300048914 | Ga0496111_0038048 | Ga0496111_0038048_264_1490 | 336 |
| 118 | 3300048916 | Ga0496113_0015774 | Ga0496113_0015774_1919_3145 | 336 |
| 119 | 3300045049 | Ga0466959_0016350 | Ga0466959_0016350_2352_3611 | 337 |
| 120 | 3300046529 | Ga0495652_0077847 | Ga0495652_0077847_982_2205 | 337 |
| 121 | 3300005344 | Ga0070661_100180732 | Ga0070661_1001807322 | 338 |
| 122 | 3300005578 | Ga0068854_100211865 | Ga0068854_1002118652 | 338 |
| 123 | 3300025981 | Ga0207640_10194945 | Ga0207640_101949452 | 338 |
| 124 | 3300045976 | Ga0466967_0010037 | Ga0466967_0010037_1291_2520 | 338 |
| 125 | 3300025915 | Ga0207693_10000028 | Ga0207693_1000002817 | 339 |
| 126 | 3300025940 | Ga0207691_10116618 | Ga0207691_101166182 | 339 |
| 127 | 3300026023 | Ga0207677_10143908 | Ga0207677_101439082 | 339 |
| 128 | 3300005435 | Ga0070714_100005051 | Ga0070714_1000050515 | 340 |
| 129 | 3300044694 | Ga0466963_0016710 | Ga0466963_0016710_2347_3612 | 340 |
| 130 | 3300005985 | Ga0081539_10006119 | Ga0081539_100061199 | 342 |
| 131 | 3300010375 | Ga0105239_10220307 | Ga0105239_102203072 | 342 |
| 132 | 3300045836 | Ga0466958_0031113 | Ga0466958_0031113_1102_2328 | 342 |
| 133 | 3300005435 | Ga0070714_100066113 | Ga0070714_1000661133 | 343 |
| 134 | 3300005614 | Ga0068856_100009596 | Ga0068856_1000095965 | 343 |
| 135 | 3300006028 | Ga0070717_10038496 | Ga0070717_100384964 | 343 |
| 136 | 3300044684 | Ga0466966_0093391 | Ga0466966_0093391_613_1845 | 343 |
| 137 | 3300044694 | Ga0466963_0041530 | Ga0466963_0041530_975_2207 | 343 |
| 138 | 3300044765 | Ga0466970_0038940 | Ga0466970_0038940_153_1385 | 343 |
| 139 | 3300021377 | Ga0213874_10000263 | Ga0213874_100002632 | 344 |
| 140 | 3300021384 | Ga0213876_10007298 | Ga0213876_100072987 | 344 |
| 141 | 3300039450 | Ga0436363_0365326 | Ga0436363_0365326_1813_3057 | 344 |
| 142 | 3300045049 | Ga0466959_0004786 | Ga0466959_0004786_817_2109 | 344 |
| 143 | 3300039437 | Ga0436365_0656592 | Ga0436365_0656592_4861_6114 | 345 |
| 144 | 3300044694 | Ga0466963_0000273 | Ga0466963_0000273_6529_7779 | 345 |
| 145 | 3300044719 | Ga0466971_0073076 | Ga0466971_0073076_140_1390 | 345 |
| 146 | 3300045836 | Ga0466958_0001164 | Ga0466958_0001164_10043_11293 | 345 |
| 147 | 3300045976 | Ga0466967_0019491 | Ga0466967_0019491_1987_3237 | 345 |
| 148 | 3300037853 | Ga0436364_0817554 | Ga0436364_0817554_1194_2453 | 346 |
| 149 | 3300039437 | Ga0436365_0912124 | Ga0436365_0912124_455_1714 | 346 |
| 150 | 3300045836 | Ga0466958_0127014 | Ga0466958_0127014_198_1442 | 347 |
| 151 | 3300005438 | Ga0070701_10075747 | Ga0070701_100757471 | 350 |
| 152 | 3300044684 | Ga0466966_0054649 | Ga0466966_0054649_816_2057 | 351 |
| 153 | 3300044693 | Ga0466961_0007269 | Ga0466961_0007269_4905_6146 | 351 |
| 154 | 3300044694 | Ga0466963_0010607 | Ga0466963_0010607_2270_3511 | 351 |
| 155 | 3300044719 | Ga0466971_0001423 | Ga0466971_0001423_7400_8641 | 351 |
| 156 | 3300044765 | Ga0466970_0037389 | Ga0466970_0037389_1192_2433 | 351 |
| 157 | 3300045049 | Ga0466959_0023017 | Ga0466959_0023017_1364_2605 | 351 |
| 158 | 3300045049 | Ga0466959_0052471 | Ga0466959_0052471_984_2285 | 351 |
| 159 | 3300045836 | Ga0466958_0002323 | Ga0466958_0002323_691_1932 | 351 |
| 160 | 3300005441 | Ga0070700_100122839 | Ga0070700_1001228392 | 352 |
| 161 | 3300037418 | Ga0395900_0008002 | Ga0395900_0008002_890_2176 | 352 |
| 162 | 3300005535 | Ga0070684_100180488 | Ga0070684_1001804883 | 353 |
| 163 | 3300039437 | Ga0436365_1785439 | Ga0436365_1785439_115_1365 | 353 |
| 164 | 3300044694 | Ga0466963_0045376 | Ga0466963_0045376_1358_2563 | 353 |
| 165 | 3300037853 | Ga0436364_1269509 | Ga0436364_1269509_613_1866 | 356 |
| 166 | 3300037853 | Ga0436364_1059319 | Ga0436364_1059319_1877_3142 | 357 |
| 167 | 3300045049 | Ga0466959_0071773 | Ga0466959_0071773_180_1508 | 358 |
| 168 | 3300048904 | Ga0496101_0001372 | Ga0496101_0001372_2272_3489 | 359 |
| 169 | 3300044694 | Ga0466963_0162806 | Ga0466963_0162806_303_1514 | 360 |
| 170 | 3300045976 | Ga0466967_0108392 | Ga0466967_0108392_1190_2401 | 360 |
| 171 | 3300049574 | Ga0501038_0122892 | Ga0501038_0122892_775_1962 | 361 |
| 172 | 3300049588 | Ga0501072_0135118 | Ga0501072_0135118_295_1482 | 361 |
| 173 | 3300049741 | Ga0501079_0067232 | Ga0501079_0067232_201_1388 | 361 |
| 174 | 3300049824 | Ga0501045_0104062 | Ga0501045_0104062_185_1372 | 361 |
| 175 | 3300054114 | Ga0501084_0114154 | Ga0501084_0114154_1027_2214 | 361 |
| 176 | 3300044694 | Ga0466963_0021787 | Ga0466963_0021787_1837_3039 | 363 |
| 177 | 3300045976 | Ga0466967_0023308 | Ga0466967_0023308_2983_4185 | 363 |
| 178 | 3300050511 | nmdc:mga08y16_82880_c1 | nmdc:mga08y16_82880_c1_742_1968 | 363 |
| 179 | 3300031852 | Ga0307410_10261176 | Ga0307410_102611762 | 364 |
| 180 | 3300042016 | Ga0439463_026256 | Ga0439463_026256_185_1417 | 365 |
| 181 | 3300014326 | Ga0157380_10216854 | Ga0157380_102168541 | 366 |
| 182 | 3300044694 | Ga0466963_0216883 | Ga0466963_0216883_96_1295 | 366 |
| 183 | 3300005339 | Ga0070660_100173820 | Ga0070660_1001738202 | 368 |
| 184 | 3300005456 | Ga0070678_100026241 | Ga0070678_1000262412 | 368 |
| 185 | 3300025908 | Ga0207643_10073449 | Ga0207643_100734492 | 368 |
| 186 | 3300025937 | Ga0207669_10249657 | Ga0207669_102496571 | 368 |
| 187 | 3300005329 | Ga0070683_100147916 | Ga0070683_1001479162 | 369 |
| 188 | 3300025932 | Ga0207690_10147618 | Ga0207690_101476182 | 369 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b2p-assembly1.cif.gz_A-2 | dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis | 0.9517 | 7 | 273 |
| 1o6y-assembly1.cif.gz_A | catalytic domain of pknb kinase from mycobacterium tuberculosis | 0.9512 | 4 | 274 |
| 2fum-assembly3.cif.gz_C | catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone | 0.95 | 4 | 274 |
| 5u94-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693. | 0.9499 | 8 | 273 |
| 6b2q-assembly1.cif.gz_D | dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis | 0.9443 | 6 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fumD02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9428 | 95 | 273 | 1.10.510.10 |
| 4eqmD02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9361 | 95 | 274 | 1.10.510.10 |
| 2fumD02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9317 | 95 | 273 | 1.10.510.10 |
| af_P9WI77_97_289_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9284 | 95 | 274 | 1.10.510.10 |
| af_Q86AE1_27_112_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9091 | 6 | 95 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S9IJZ9-F1-model_v4 | Protein kinase | 0.946 | 12 | 272 |
GO:0004674
GO:0005524 |
| AF-A0A538AFT8-F1-model_v4 | non-specific serine/threonine protein kinase (EC 2.7.11.1) | 0.9407 | 1 | 276 |
GO:0004676
GO:0004677 GO:0004679 GO:0004711 GO:0005524 GO:0035175 GO:0035402 GO:0035403 GO:0035979 GO:0044022 GO:0044023 GO:0044024 GO:0044025 GO:0072354 GO:0072371 GO:0072518 GO:0140823 GO:0140855 GO:0140857 GO:1990244 |
| AF-A0A849ZH37-F1-model_v4 | Protein kinase | 0.9387 | 6 | 144 |
GO:0004674
GO:0005524 |
| AF-A0A535CT31-F1-model_v4 | Serine/threonine protein kinase | 0.9336 | 9 | 154 |
GO:0004676
GO:0004677 GO:0004679 GO:0004711 GO:0005524 GO:0035175 GO:0035402 GO:0035403 GO:0035979 GO:0044022 GO:0044023 GO:0044024 GO:0044025 GO:0072354 GO:0072371 GO:0072518 GO:0140823 GO:0140855 GO:0140857 GO:1990244 |
| AF-A0A542GAQ1-F1-model_v4 | Protein kinase-like protein | 0.9336 | 12 | 96 |
GO:0004672
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar