F289674

General Info

Members Datasets Scaffolds Average Seq Length
188 113 376 454

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0032317|Ga0373947_0032317_626_2122
Length 498
Sequence MLASLRSGALSNTAEGAERNPRPWNSRRAGYVLAALASDSQTADAQTAAKRDRLILVACILGSVIVFVDSTVVNVALPAIERDLGGGLALQQWVVDAYLLTLGSLLLVGGSLGDLFGARRLFLIGIVTFGLTSILCAAAPDGTTLIFARGLQGVTAALLTPAGLAVIAATFHGEERGAAIGAWTAWTGIAFVIGPLAGGWLVTHVSWRWIFIVNVPFAVATAALVAYAVPKSHHEGQRARVDVVGGVLCAAGLAGPVFALIEAPRRGFSDPVILATLFGGIALLVAFGLWERRVPQPMLPLRLFRRRNFSFANLETLTVYAGLSTLTFFLVLYLQQIAGYSALESGLALVPITLVMFVLSPRVGRLSMRFGPRLFMGAGPLVAAAALLPMLRLGHEFSYWTELLPALLVFSVGLSMTVAPLTATVLADAGESDAGIASGVNNAVARVAGLLGIAVLGAAAAGSTNSLDLSGFHLSMAITAALVAAGGAIGLAGIRNRR

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
112 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
113 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 1.6
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.85
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0032317 3300035725 Bacteria 3083
2 Ga0070658_10006698 3300005327 Bacteria 9327
3 Ga0070683_100018722 3300005329 Bacteria 6137
4 Ga0070683_100063255 3300005329 Bacteria 3442
5 Ga0070690_100081328 3300005330 Bacteria 2119
6 Ga0070680_100012712 3300005336 Bacteria 6542
7 Ga0070680_100043151 3300005336 Bacteria 3662
8 Ga0070660_100021367 3300005339 Bacteria 4772
9 Ga0070660_100047372 3300005339 Bacteria 3298
10 Ga0070661_100046997 3300005344 Bacteria 3158
11 Ga0070659_100125340 3300005366 Bacteria 2083
12 Ga0070667_100087313 3300005367 Bacteria 2677
13 Ga0070713_100101548 3300005436 Bacteria 2492
14 Ga0070681_10000130 3300005458 Bacteria 56536
15 Ga0070681_10006341 3300005458 Bacteria 11502
16 Ga0070681_10033305 3300005458 Bacteria 5172
17 Ga0070685_10016021 3300005466 Bacteria 3987
18 Ga0070698_100142425 3300005471 Bacteria 2348
19 Ga0070679_100008887 3300005530 Bacteria 9480
20 Ga0070679_100023484 3300005530 Bacteria 6036
21 Ga0070679_100046843 3300005530 Bacteria 4310
22 Ga0070679_100161923 3300005530 Bacteria 2212
23 Ga0070679_100200736 3300005530 Bacteria 1960
24 Ga0070684_100035735 3300005535 Bacteria 4254
25 Ga0070684_100112927 3300005535 Bacteria 2438
26 Ga0070686_100046568 3300005544 Bacteria 2737
27 Ga0070665_100266711 3300005548 Bacteria 1713
28 Ga0068855_100039850 3300005563 Bacteria 5576
29 Ga0068855_100045671 3300005563 Bacteria 5180
30 Ga0068855_100072231 3300005563 Bacteria 4011
31 Ga0068855_100122568 3300005563 Bacteria 2974
32 Ga0068859_100029250 3300005617 Bacteria 5528
33 Ga0097621_100221003 3300006237 Bacteria 1651
34 Ga0068865_100107391 3300006881 Bacteria 2053
35 Ga0097620_100029252 3300006931 Bacteria 5528
36 Ga0105240_10033881 3300009093 Bacteria 6594
37 Ga0105240_10052103 3300009093 Bacteria 5145
38 Ga0105240_10101936 3300009093 Bacteria 3489
39 Ga0105240_10235698 3300009093 Bacteria 2124
40 Ga0105247_10037948 3300009101 Bacteria 2939
41 Ga0105248_10161537 3300009177 Bacteria 2527
42 Ga0105238_10093703 3300009551 Bacteria 2991
43 Ga0105238_10180334 3300009551 Bacteria 2089
44 Ga0105239_10035240 3300010375 Bacteria 5497
45 Ga0157370_10034310 3300013104 Bacteria 4943
46 Ga0157370_10039933 3300013104 Bacteria 4533
47 Ga0157369_10000274 3300013105 Bacteria 69432
48 Ga0157369_10001416 3300013105 Bacteria 29494
49 Ga0157369_10063017 3300013105 Bacteria 3995
50 Ga0157369_10231381 3300013105 Bacteria 1932
51 Ga0206354_10047282 3300020081 Bacteria 2460
52 Ga0206354_10135736 3300020081 Bacteria 3716
53 Ga0206353_10841162 3300020082 Bacteria 2324
54 Ga0207705_10013392 3300025909 Bacteria 5916
55 Ga0207707_10002474 3300025912 Bacteria 16635
56 Ga0207707_10027448 3300025912 Bacteria 4978
57 Ga0207707_10038982 3300025912 Bacteria 4153
58 Ga0207707_10141871 3300025912 Bacteria 2100
59 Ga0207695_10172009 3300025913 Bacteria 2091
60 Ga0207695_10232260 3300025913 Bacteria 1748
61 Ga0207693_10054639 3300025915 Bacteria 3132
62 Ga0207660_10061482 3300025917 Bacteria 2703
63 Ga0207660_10124638 3300025917 Bacteria 1955
64 Ga0207657_10000331 3300025919 Bacteria 50115
65 Ga0207657_10001176 3300025919 Bacteria 27761
66 Ga0207657_10022226 3300025919 Bacteria 5945
67 Ga0207657_10040868 3300025919 Bacteria 4106
68 Ga0207649_10035341 3300025920 Bacteria 3002
69 Ga0207690_10055400 3300025932 Bacteria 2670
70 Ga0207689_10137778 3300025942 Bacteria 2010
71 Ga0207661_10237158 3300025944 Bacteria 1617
72 Ga0207658_10011476 3300025986 Bacteria 6030
73 Ga0207639_10165239 3300026041 Bacteria 1869
74 Ga0207674_10063265 3300026116 Bacteria 3735
75 Ga0268264_10029198 3300028381 Bacteria 4516
76 Ga0265338_10117725 3300028800 Bacteria 2125
77 Ga0265338_10133396 3300028800 Bacteria 1956
78 Ga0265329_10024579 3300031242 Bacteria 1999
79 Ga0265327_10054666 3300031251 Bacteria 2065
80 Ga0265314_10062468 3300031711 Bacteria 2531
81 Ga0307409_100167181 3300031995 Bacteria 1931
82 Ga0373947_0011455 3300035725 Bacteria 5087
83 Ga0373925_0008758 3300037068 Bacteria 7370
84 Ga0373925_0014200 3300037068 Bacteria 5763
85 Ga0373925_0036014 3300037068 Bacteria 3653
86 Ga0395900_0018413 3300037418 Bacteria 7123
87 Ga0395900_0042534 3300037418 Bacteria 4682
88 Ga0395900_0050144 3300037418 Bacteria 4300
89 Ga0395900_0066476 3300037418 Bacteria 3704
90 Ga0395900_0076813 3300037418 Bacteria 3432
91 Ga0395900_0148195 3300037418 Bacteria 2399
92 Ga0395898_0002058 3300037466 Bacteria 25043
93 Ga0395905_0021537 3300037471 Bacteria 6095
94 Ga0436364_0479758 3300037853 Bacteria 2427
95 Ga0395901_0020356 3300038443 Bacteria 6792
96 Ga0395901_0148504 3300038443 Bacteria 2463
97 Ga0466966_0024037 3300044684 Bacteria 3988
98 Ga0466966_0036692 3300044684 Bacteria 3164
99 Ga0466966_0052891 3300044684 Bacteria 2578
100 Ga0466966_0076572 3300044684 Bacteria 2089
101 Ga0466961_0003069 3300044693 Bacteria 10377
102 Ga0466963_0001066 3300044694 Bacteria 14288
103 Ga0466963_0001508 3300044694 Bacteria 12594
104 Ga0466963_0005130 3300044694 Bacteria 7650
105 Ga0466963_0014597 3300044694 Bacteria 4848
106 Ga0466963_0017763 3300044694 Bacteria 4437
107 Ga0466963_0025151 3300044694 Bacteria 3795
108 Ga0466963_0105815 3300044694 Bacteria 1929
109 Ga0466964_0039748 3300044706 Bacteria 1897
110 Ga0466971_0002047 3300044719 Bacteria 8537
111 Ga0466970_0060577 3300044765 Bacteria 2027
112 Ga0466957_0003424 3300044842 Bacteria 8708
113 Ga0466959_0008353 3300045049 Bacteria 7316
114 Ga0466959_0018388 3300045049 Bacteria 5129
115 Ga0466959_0053867 3300045049 Bacteria 2940
116 Ga0466959_0096305 3300045049 Bacteria 2122
117 Ga0466958_0004000 3300045836 Bacteria 7727
118 Ga0466958_0012267 3300045836 Bacteria 4851
119 Ga0466967_0000905 3300045976 Bacteria 15884
120 Ga0466967_0002717 3300045976 Bacteria 11184
121 Ga0466967_0009939 3300045976 Bacteria 7103
122 Ga0466967_0019081 3300045976 Bacteria 5505
123 Ga0466967_0037360 3300045976 Bacteria 4155
124 Ga0466967_0039808 3300045976 Bacteria 4043
125 Ga0466967_0041409 3300045976 Bacteria 3971
126 Ga0466967_0044710 3300045976 Bacteria 3843
127 Ga0466967_0045510 3300045976 Bacteria 3813
128 Ga0466967_0058168 3300045976 Bacteria 3416
129 Ga0466967_0112512 3300045976 Bacteria 2503
130 Ga0495629_0004127 3300046459 Bacteria 10893
131 Ga0495641_0003032 3300046461 Bacteria 12847
132 Ga0495651_0084825 3300046462 Bacteria 2386
133 Ga0495582_0000050 3300046473 Bacteria 59164
134 Ga0495639_0000657 3300046475 Bacteria 15977
135 Ga0495662_0030887 3300046476 Bacteria 2586
136 Ga0495628_0036175 3300046516 Bacteria 3964
137 Ga0495652_0018011 3300046529 Bacteria 6301
138 Ga0495645_0002374 3300046543 Bacteria 12771
139 Ga0495667_0076950 3300046559 Bacteria 2170
140 Ga0495667_0077278 3300046559 Bacteria 2165
141 Ga0495634_0007348 3300046642 Bacteria 8290
142 Ga0495635_0004530 3300046663 Bacteria 9633
143 Ga0495635_0086217 3300046663 Bacteria 2149
144 Ga0495657_0012200 3300046675 Bacteria 6393
145 Ga0495658_0000020 3300046683 Bacteria 87200
146 Ga0495613_0056520 3300046689 Bacteria 2881
147 Ga0495624_0034316 3300046690 Bacteria 3282
148 Ga0495604_0089100 3300047317 Bacteria 2294
149 Ga0495674_0091847 3300047319 Bacteria 2592
150 Ga0495674_0203555 3300047319 Bacteria 1641
151 Ga0495676_0135203 3300047321 Bacteria 1774
152 Ga0495680_0004639 3300047322 Bacteria 13093
153 Ga0495684_0023930 3300047471 Bacteria 4697
154 Ga0495684_0029738 3300047471 Bacteria 4192
155 Ga0495593_0069113 3300047673 Bacteria 1837
156 Ga0496100_0003015 3300048903 Bacteria 8688
157 Ga0496100_0014672 3300048903 Bacteria 4556
158 Ga0496101_0021123 3300048904 Bacteria 4469
159 Ga0496101_0101891 3300048904 Bacteria 2150
160 Ga0496104_0025142 3300048907 Bacteria 5488
161 Ga0496105_0065696 3300048908 Bacteria 2994
162 Ga0496106_0011119 3300048909 Bacteria 6657
163 Ga0496110_0101232 3300048913 Bacteria 2583
164 Ga0496111_0119572 3300048914 Bacteria 1946
165 Ga0496114_0002044 3300048917 Bacteria 15364
166 Ga0496115_0001320 3300048918 Bacteria 17679
167 Ga0501033_0045400 3300049570 Bacteria 3270
168 Ga0501036_0027309 3300049572 Bacteria 4823
169 Ga0501047_0012771 3300049581 Bacteria 7958
170 Ga0501047_0159468 3300049581 Bacteria 2128
171 Ga0501047_0166189 3300049581 Bacteria 2077
172 Ga0501067_0002759 3300049583 Bacteria 9667
173 Ga0501069_0000719 3300049585 Bacteria 15415
174 Ga0501070_0001185 3300049586 Bacteria 23305
175 Ga0501072_0011912 3300049588 Bacteria 6641
176 Ga0501079_0026248 3300049741 Bacteria 4465
177 Ga0501080_0023725 3300049742 Bacteria 5683
178 Ga0501080_0060275 3300049742 Bacteria 3532
179 Ga0501083_0000442 3300049744 Bacteria 26662
180 Ga0501083_0004406 3300049744 Bacteria 9926
181 Ga0501045_0004362 3300049824 Bacteria 9750
182 Ga0495619_0008045 3300053085 Bacteria 6673
183 Ga0495619_0009058 3300053085 Bacteria 6280
184 Ga0501082_0076964 3300060353 Bacteria 2876
185 Ga0501082_0151936 3300060353 Bacteria 2011
186 Ga0466962_0004673 3300061719 Bacteria 6575
187 2902796432 2902792274 Bacteria 7270173
188 2902840335 2902837492 Bacteria 6697721
189 Ga0373947_0032317
190 Ga0070658_10006698
191 Ga0070683_100018722
192 Ga0070683_100063255
193 Ga0070690_100081328
194 Ga0070680_100012712
195 Ga0070680_100043151
196 Ga0070660_100021367
197 Ga0070660_100047372
198 Ga0070661_100046997
199 Ga0070659_100125340
200 Ga0070667_100087313
201 Ga0070713_100101548
202 Ga0070681_10000130
203 Ga0070681_10006341
204 Ga0070681_10033305
205 Ga0070685_10016021
206 Ga0070698_100142425
207 Ga0070679_100008887
208 Ga0070679_100023484
209 Ga0070679_100046843
210 Ga0070679_100161923
211 Ga0070679_100200736
212 Ga0070684_100035735
213 Ga0070684_100112927
214 Ga0070686_100046568
215 Ga0070665_100266711
216 Ga0068855_100039850
217 Ga0068855_100045671
218 Ga0068855_100072231
219 Ga0068855_100122568
220 Ga0068859_100029250
221 Ga0097621_100221003
222 Ga0068865_100107391
223 Ga0097620_100029252
224 Ga0105240_10033881
225 Ga0105240_10052103
226 Ga0105240_10101936
227 Ga0105240_10235698
228 Ga0105247_10037948
229 Ga0105248_10161537
230 Ga0105238_10093703
231 Ga0105238_10180334
232 Ga0105239_10035240
233 Ga0157370_10034310
234 Ga0157370_10039933
235 Ga0157369_10000274
236 Ga0157369_10001416
237 Ga0157369_10063017
238 Ga0157369_10231381
239 Ga0206354_10047282
240 Ga0206354_10135736
241 Ga0206353_10841162
242 Ga0207705_10013392
243 Ga0207707_10002474
244 Ga0207707_10027448
245 Ga0207707_10038982
246 Ga0207707_10141871
247 Ga0207695_10172009
248 Ga0207695_10232260
249 Ga0207693_10054639
250 Ga0207660_10061482
251 Ga0207660_10124638
252 Ga0207657_10000331
253 Ga0207657_10001176
254 Ga0207657_10022226
255 Ga0207657_10040868
256 Ga0207649_10035341
257 Ga0207690_10055400
258 Ga0207689_10137778
259 Ga0207661_10237158
260 Ga0207658_10011476
261 Ga0207639_10165239
262 Ga0207674_10063265
263 Ga0268264_10029198
264 Ga0265338_10117725
265 Ga0265338_10133396
266 Ga0265329_10024579
267 Ga0265327_10054666
268 Ga0265314_10062468
269 Ga0307409_100167181
270 Ga0373947_0011455
271 Ga0373925_0008758
272 Ga0373925_0014200
273 Ga0373925_0036014
274 Ga0395900_0018413
275 Ga0395900_0042534
276 Ga0395900_0050144
277 Ga0395900_0066476
278 Ga0395900_0076813
279 Ga0395900_0148195
280 Ga0395898_0002058
281 Ga0395905_0021537
282 Ga0436364_0479758
283 Ga0395901_0020356
284 Ga0395901_0148504
285 Ga0466966_0024037
286 Ga0466966_0036692
287 Ga0466966_0052891
288 Ga0466966_0076572
289 Ga0466961_0003069
290 Ga0466963_0001066
291 Ga0466963_0001508
292 Ga0466963_0005130
293 Ga0466963_0014597
294 Ga0466963_0017763
295 Ga0466963_0025151
296 Ga0466963_0105815
297 Ga0466964_0039748
298 Ga0466971_0002047
299 Ga0466970_0060577
300 Ga0466957_0003424
301 Ga0466959_0008353
302 Ga0466959_0018388
303 Ga0466959_0053867
304 Ga0466959_0096305
305 Ga0466958_0004000
306 Ga0466958_0012267
307 Ga0466967_0000905
308 Ga0466967_0002717
309 Ga0466967_0009939
310 Ga0466967_0019081
311 Ga0466967_0037360
312 Ga0466967_0039808
313 Ga0466967_0041409
314 Ga0466967_0044710
315 Ga0466967_0045510
316 Ga0466967_0058168
317 Ga0466967_0112512
318 Ga0495629_0004127
319 Ga0495641_0003032
320 Ga0495651_0084825
321 Ga0495582_0000050
322 Ga0495639_0000657
323 Ga0495662_0030887
324 Ga0495628_0036175
325 Ga0495652_0018011
326 Ga0495645_0002374
327 Ga0495667_0076950
328 Ga0495667_0077278
329 Ga0495634_0007348
330 Ga0495635_0004530
331 Ga0495635_0086217
332 Ga0495657_0012200
333 Ga0495658_0000020
334 Ga0495613_0056520
335 Ga0495624_0034316
336 Ga0495604_0089100
337 Ga0495674_0091847
338 Ga0495674_0203555
339 Ga0495676_0135203
340 Ga0495680_0004639
341 Ga0495684_0023930
342 Ga0495684_0029738
343 Ga0495593_0069113
344 Ga0496100_0003015
345 Ga0496100_0014672
346 Ga0496101_0021123
347 Ga0496101_0101891
348 Ga0496104_0025142
349 Ga0496105_0065696
350 Ga0496106_0011119
351 Ga0496110_0101232
352 Ga0496111_0119572
353 Ga0496114_0002044
354 Ga0496115_0001320
355 Ga0501033_0045400
356 Ga0501036_0027309
357 Ga0501047_0012771
358 Ga0501047_0159468
359 Ga0501047_0166189
360 Ga0501067_0002759
361 Ga0501069_0000719
362 Ga0501070_0001185
363 Ga0501072_0011912
364 Ga0501079_0026248
365 Ga0501080_0023725
366 Ga0501080_0060275
367 Ga0501083_0000442
368 Ga0501083_0004406
369 Ga0501045_0004362
370 Ga0495619_0008045
371 Ga0495619_0009058
372 Ga0501082_0076964
373 Ga0501082_0151936
374 Ga0466962_0004673
375 2902796432
376 2902840335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

59

453

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8872 2 437
6vs2-assembly1.cif.gz_A protein d 0.855 2 437
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8544 2 437
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8526 2 436
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8517 2 437
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9766 4 176 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9651 1 195 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9617 3 210 1.20.1250.20
af_P9WJY5_55_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9589 1 245 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9555 1 195 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Y6CEC9-F1-model_v4 DHA2 family efflux MFS transporter permease subunit 0.994 2 444 GO:0005886
GO:0022857
AF-A0A7Y6CEC9-F1-model_v4 DHA2 family efflux MFS transporter permease subunit 0.9896 2 444 GO:0005886
GO:0022857
AF-A0A7M4DS12-F1-model_v4 Antiseptic resistance protein 0.988 2 444 GO:0016020
GO:0022857
AF-A0A251YLA4-F1-model_v4 Antiseptic resistance protein 0.9879 2 442 GO:0016020
GO:0022857
AF-A0A2D9NWE8-F1-model_v4 deleted 0.9861 2 443

Map