F289584

General Info

Members Datasets Scaffolds Average Seq Length
188 102 376 430

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10088658|Ga0265338_100886582
Length 420
Sequence MHDFHYVGGKLFCEGIAIETLAEKFGTPLYVYSQRTLTEHYRKLDAVMSQVDHLICFALKANGNLSVLRTLANLGSGFDIVSGGELQRVIAAGGDPRQCVFAGVGKTEEEIEFALRRNIYSFNAESEPELRRINKVAARPNVEAHTHAKITTGTYENKFGVAFEEIEGVYARAGRLPNLRLRGLQMHIGSQITDAAPFEQAVRKVLPLVRKLAAKYALEFFSIGGGLGIVYQPALASGAAAWWNSPAAKNILTPQKYAKRLLPLLRPLGLKLLLEPGRFICGNAGILVTRVEFVKKTGRKDFVIVDAAMNDLIRPAFYDAHHEIVPVVKKGGALISSDVVGGICESGDYFCKDRPLPKVGEGDRLALMSAGAYGFVMASNYNARPLAAEILVNGKKAAVARERQAAKEIWSGEKVVAWLR

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
5 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
12 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
37 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
38 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
39 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
42 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
48 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 99.47
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10088658 3300028800 Bacteria 2566
2 Ga0070666_10040324 3300005335 Bacteria 3116
3 Ga0070689_100002738 3300005340 Bacteria 11556
4 Ga0070689_100032984 3300005340 Bacteria 3943
5 Ga0070679_100263541 3300005530 Bacteria 1678
6 Ga0068857_100003720 3300005577 Bacteria 12802
7 Ga0068856_100000172 3300005614 Bacteria 67506
8 Ga0068859_100052068 3300005617 Bacteria 4116
9 Ga0068859_100330251 3300005617 Bacteria 1619
10 Ga0068858_100062258 3300005842 Bacteria 3450
11 Ga0068871_100095151 3300006358 Bacteria 2487
12 Ga0075431_100112074 3300006847 Bacteria 2815
13 Ga0075431_100224194 3300006847 Bacteria 1917
14 Ga0075434_100084248 3300006871 Bacteria 3178
15 Ga0075434_100223185 3300006871 Bacteria 1904
16 Ga0097620_100052068 3300006931 Bacteria 4116
17 Ga0097620_100330241 3300006931 Bacteria 1619
18 Ga0105240_10012859 3300009093 Bacteria 11532
19 Ga0105240_10092670 3300009093 Bacteria 3689
20 Ga0105240_10151729 3300009093 Bacteria 2759
21 Ga0105240_10265893 3300009093 Bacteria 1977
22 Ga0111539_10002816 3300009094 Bacteria 23104
23 Ga0114129_10374394 3300009147 Bacteria 1881
24 Ga0105238_10010690 3300009551 Bacteria 9218
25 Ga0105238_10137280 3300009551 Bacteria 2423
26 Ga0157370_10090933 3300013104 Bacteria 2866
27 Ga0157375_10000074 3300013308 Bacteria 103033
28 Ga0157375_10212357 3300013308 Bacteria 2093
29 Ga0163163_10000096 3300014325 Bacteria 93313
30 Ga0163163_10061027 3300014325 Bacteria 3735
31 Ga0157376_10075659 3300014969 Unclassified 2874
32 Ga0207695_10117845 3300025913 Unclassified 2627
33 Ga0207695_10208417 3300025913 Bacteria 1866
34 Ga0207694_10065973 3300025924 Bacteria 2823
35 Ga0207670_10001668 3300025936 Bacteria 11573
36 Ga0207667_10116186 3300025949 Bacteria 2757
37 Ga0207703_10030113 3300026035 Bacteria 4288
38 Ga0207702_10005923 3300026078 Bacteria 10619
39 Ga0207648_10252290 3300026089 Bacteria 1573
40 Ga0207674_10054305 3300026116 Bacteria 4079
41 Ga0207428_10053694 3300027907 Bacteria 3212
42 Ga0265337_1000147 3300028556 Bacteria 35245
43 Ga0265337_1000662 3300028556 Bacteria 18144
44 Ga0265337_1014960 3300028556 Bacteria 2557
45 Ga0265319_1000003 3300028563 Bacteria 340561
46 Ga0265319_1002975 3300028563 Bacteria 9011
47 Ga0265319_1008050 3300028563 Bacteria 4660
48 Ga0265334_10011981 3300028573 Bacteria 3643
49 Ga0265318_10009849 3300028577 Bacteria 4188
50 Ga0265323_10000461 3300028653 Bacteria 23032
51 Ga0265323_10020966 3300028653 Bacteria 2508
52 Ga0265336_10000289 3300028666 Bacteria 34559
53 Ga0265336_10041710 3300028666 Bacteria 1402
54 Ga0265338_10000050 3300028800 Bacteria 213659
55 Ga0265338_10000075 3300028800 Bacteria 180334
56 Ga0265338_10000088 3300028800 Bacteria 174641
57 Ga0265338_10000111 3300028800 Bacteria 151469
58 Ga0265338_10000399 3300028800 Bacteria 77917
59 Ga0265338_10001952 3300028800 Bacteria 32165
60 Ga0265338_10002179 3300028800 Bacteria 30072
61 Ga0265338_10002760 3300028800 Bacteria 25721
62 Ga0265338_10006018 3300028800 Bacteria 15584
63 Ga0265338_10010832 3300028800 Bacteria 10619
64 Ga0265338_10011698 3300028800 Bacteria 10103
65 Ga0265338_10023776 3300028800 Bacteria 6284
66 Ga0265338_10030587 3300028800 Bacteria 5300
67 Ga0265338_10043012 3300028800 Bacteria 4197
68 Ga0265338_10049116 3300028800 Bacteria 3829
69 Ga0265338_10065805 3300028800 Bacteria 3141
70 Ga0265338_10068202 3300028800 Bacteria 3066
71 Ga0265324_10000581 3300029957 Bacteria 24955
72 Ga0265324_10003337 3300029957 Bacteria 7694
73 Ga0265324_10016440 3300029957 Bacteria 2701
74 Ga0265320_10002026 3300031240 Bacteria 14284
75 Ga0265320_10004024 3300031240 Bacteria 9659
76 Ga0265320_10007919 3300031240 Bacteria 6557
77 Ga0265320_10009852 3300031240 Bacteria 5726
78 Ga0265320_10014610 3300031240 Bacteria 4462
79 Ga0265320_10040632 3300031240 Bacteria 2318
80 Ga0265325_10029000 3300031241 Bacteria 2977
81 Ga0265329_10003325 3300031242 Bacteria 7033
82 Ga0265340_10000492 3300031247 Bacteria 21623
83 Ga0265340_10003102 3300031247 Bacteria 9425
84 Ga0265340_10057381 3300031247 Bacteria 1871
85 Ga0265339_10013409 3300031249 Bacteria 4968
86 Ga0265339_10036248 3300031249 Bacteria 2762
87 Ga0265327_10004383 3300031251 Bacteria 12527
88 Ga0265327_10013551 3300031251 Bacteria 5408
89 Ga0265327_10055338 3300031251 Bacteria 2050
90 Ga0265316_10001020 3300031344 Bacteria 30389
91 Ga0265316_10005606 3300031344 Bacteria 12163
92 Ga0265316_10009983 3300031344 Bacteria 8688
93 Ga0265316_10041848 3300031344 Bacteria 3664
94 Ga0265316_10064417 3300031344 Bacteria 2839
95 Ga0265313_10005812 3300031595 Bacteria 8958
96 Ga0265313_10021603 3300031595 Bacteria 3515
97 Ga0265314_10002965 3300031711 Bacteria 16822
98 Ga0265314_10033199 3300031711 Bacteria 3788
99 Ga0265314_10117678 3300031711 Bacteria 1678
100 Ga0307412_10154761 3300031911 Bacteria 1696
101 Ga0373954_0002170 3300035118 Bacteria 8155
102 Ga0373954_0005517 3300035118 Bacteria 5472
103 Ga0373956_0004536 3300035119 Bacteria 5548
104 Ga0373946_0030764 3300035171 Unclassified 2145
105 Ga0316574_0070821 3300035398 Bacteria 2202
106 Ga0373924_0026573 3300035410 Bacteria 2297
107 Ga0373935_0030427 3300035692 Bacteria 3346
108 Ga0373927_0006378 3300035695 Bacteria 8036
109 Ga0373927_0008195 3300035695 Bacteria 7042
110 Ga0373947_0087981 3300035725 Bacteria 1933
111 Ga0373937_0005678 3300036401 Bacteria 10710
112 Ga0373925_0005684 3300037068 Bacteria 9269
113 Ga0373925_0015393 3300037068 Bacteria 5529
114 Ga0451577_0004315 3300042876 Bacteria 15094
115 Ga0451577_0024825 3300042876 Bacteria 5446
116 Ga0453684_0004469 3300044712 Bacteria 29460
117 Ga0451576_0022730 3300045051 Bacteria 6794
118 Ga0451576_0028740 3300045051 Bacteria 5954
119 Ga0451576_0099959 3300045051 Bacteria 3017
120 Ga0451576_0102942 3300045051 Bacteria 2970
121 Ga0451576_0250732 3300045051 Bacteria 1850
122 Ga0451576_0354916 3300045051 Bacteria 1535
123 Ga0495592_0000180 3300046454 Bacteria 55455
124 Ga0495629_0118713 3300046459 Bacteria 1843
125 Ga0495641_0075217 3300046461 Bacteria 1514
126 Ga0495651_0145919 3300046462 Bacteria 1711
127 Ga0495582_0032723 3300046473 Bacteria 2858
128 Ga0495639_0030958 3300046475 Bacteria 2380
129 Ga0495662_0020755 3300046476 Bacteria 3178
130 Ga0495664_0022393 3300046477 Bacteria 3662
131 Ga0495618_0003398 3300046514 Bacteria 9912
132 Ga0495618_0016798 3300046514 Unclassified 4481
133 Ga0495628_0000045 3300046516 Bacteria 98769
134 Ga0495628_0057718 3300046516 Unclassified 3054
135 Ga0495628_0178776 3300046516 Bacteria 1606
136 Ga0495630_0000318 3300046517 Bacteria 38584
137 Ga0495630_0021290 3300046517 Bacteria 4788
138 Ga0495630_0032756 3300046517 Bacteria 3874
139 Ga0495630_0101094 3300046517 Bacteria 2181
140 Ga0495666_0003635 3300046526 Bacteria 7790
141 Ga0495666_0006565 3300046526 Bacteria 5852
142 Ga0495652_0021342 3300046529 Bacteria 5759
143 Ga0495640_0053764 3300046533 Bacteria 2760
144 Ga0495640_0148689 3300046533 Bacteria 1506
145 Ga0495586_0000205 3300046535 Bacteria 39531
146 Ga0495586_0000477 3300046535 Bacteria 23932
147 Ga0495586_0026911 3300046535 Unclassified 3078
148 Ga0495586_0040068 3300046535 Unclassified 2519
149 Ga0495621_0026087 3300046539 Bacteria 1968
150 Ga0495645_0005972 3300046543 Bacteria 8421
151 Ga0495645_0007100 3300046543 Bacteria 7796
152 Ga0495645_0154047 3300046543 Bacteria 1594
153 Ga0495622_0031096 3300046557 Bacteria 2496
154 Ga0495667_0072094 3300046559 Bacteria 2252
155 Ga0495667_0106919 3300046559 Unclassified 1808
156 Ga0495634_0005142 3300046642 Bacteria 10102
157 Ga0495635_0099602 3300046663 Unclassified 1986
158 Ga0495599_0024046 3300046678 Bacteria 3810
159 Ga0495647_0023822 3300046681 Unclassified 2223
160 Ga0495658_0006210 3300046683 Bacteria 5869
161 Ga0495613_0001737 3300046689 Bacteria 16578
162 Ga0495613_0032010 3300046689 Bacteria 3907
163 Ga0495624_0066242 3300046690 Unclassified 2255
164 Ga0495674_0006767 3300047319 Bacteria 10974
165 Ga0495674_0007990 3300047319 Bacteria 10098
166 Ga0495674_0123853 3300047319 Bacteria 2182
167 Ga0495676_0010642 3300047321 Bacteria 8331
168 Ga0495680_0004846 3300047322 Bacteria 12761
169 Ga0495684_0105071 3300047471 Bacteria 2134
170 Ga0495684_0188676 3300047471 Unclassified 1525
171 Ga0496106_0114697 3300048909 Bacteria 2101
172 Ga0501032_0009026 3300049569 Bacteria 7246
173 Ga0501033_0001416 3300049570 Bacteria 21301
174 Ga0501033_0052102 3300049570 Bacteria 3033
175 Ga0501043_0027853 3300049579 Bacteria 4435
176 Ga0501070_0098013 3300049586 Bacteria 2425
177 Ga0501080_0005576 3300049742 Bacteria 11246
178 Ga0501035_0019572 3300049822 Bacteria 6220
179 Ga0501035_0021858 3300049822 Bacteria 5878
180 Ga0501035_0028355 3300049822 Bacteria 5111
181 Ga0501044_0000125 3300049823 Bacteria 92969
182 Ga0501044_0143039 3300049823 Unclassified 2379
183 nmdc:mga09592_77809_c1 3300050508 Bacteria 2822
184 nmdc:mga06r32_180724_c1 3300050510 Bacteria 2095
185 nmdc:mga08y16_112473_c1 3300050511 Bacteria 2834
186 nmdc:mga08y16_58789_c1 3300050511 Bacteria 4017
187 nmdc:mga0n895_82333_c1 3300050512 Bacteria 3208
188 Ga0495601_0184198 3300053077 Bacteria 1365
189 Ga0265338_10088658
190 Ga0070666_10040324
191 Ga0070689_100002738
192 Ga0070689_100032984
193 Ga0070679_100263541
194 Ga0068857_100003720
195 Ga0068856_100000172
196 Ga0068859_100052068
197 Ga0068859_100330251
198 Ga0068858_100062258
199 Ga0068871_100095151
200 Ga0075431_100112074
201 Ga0075431_100224194
202 Ga0075434_100084248
203 Ga0075434_100223185
204 Ga0097620_100052068
205 Ga0097620_100330241
206 Ga0105240_10012859
207 Ga0105240_10092670
208 Ga0105240_10151729
209 Ga0105240_10265893
210 Ga0111539_10002816
211 Ga0114129_10374394
212 Ga0105238_10010690
213 Ga0105238_10137280
214 Ga0157370_10090933
215 Ga0157375_10000074
216 Ga0157375_10212357
217 Ga0163163_10000096
218 Ga0163163_10061027
219 Ga0157376_10075659
220 Ga0207695_10117845
221 Ga0207695_10208417
222 Ga0207694_10065973
223 Ga0207670_10001668
224 Ga0207667_10116186
225 Ga0207703_10030113
226 Ga0207702_10005923
227 Ga0207648_10252290
228 Ga0207674_10054305
229 Ga0207428_10053694
230 Ga0265337_1000147
231 Ga0265337_1000662
232 Ga0265337_1014960
233 Ga0265319_1000003
234 Ga0265319_1002975
235 Ga0265319_1008050
236 Ga0265334_10011981
237 Ga0265318_10009849
238 Ga0265323_10000461
239 Ga0265323_10020966
240 Ga0265336_10000289
241 Ga0265336_10041710
242 Ga0265338_10000050
243 Ga0265338_10000075
244 Ga0265338_10000088
245 Ga0265338_10000111
246 Ga0265338_10000399
247 Ga0265338_10001952
248 Ga0265338_10002179
249 Ga0265338_10002760
250 Ga0265338_10006018
251 Ga0265338_10010832
252 Ga0265338_10011698
253 Ga0265338_10023776
254 Ga0265338_10030587
255 Ga0265338_10043012
256 Ga0265338_10049116
257 Ga0265338_10065805
258 Ga0265338_10068202
259 Ga0265324_10000581
260 Ga0265324_10003337
261 Ga0265324_10016440
262 Ga0265320_10002026
263 Ga0265320_10004024
264 Ga0265320_10007919
265 Ga0265320_10009852
266 Ga0265320_10014610
267 Ga0265320_10040632
268 Ga0265325_10029000
269 Ga0265329_10003325
270 Ga0265340_10000492
271 Ga0265340_10003102
272 Ga0265340_10057381
273 Ga0265339_10013409
274 Ga0265339_10036248
275 Ga0265327_10004383
276 Ga0265327_10013551
277 Ga0265327_10055338
278 Ga0265316_10001020
279 Ga0265316_10005606
280 Ga0265316_10009983
281 Ga0265316_10041848
282 Ga0265316_10064417
283 Ga0265313_10005812
284 Ga0265313_10021603
285 Ga0265314_10002965
286 Ga0265314_10033199
287 Ga0265314_10117678
288 Ga0307412_10154761
289 Ga0373954_0002170
290 Ga0373954_0005517
291 Ga0373956_0004536
292 Ga0373946_0030764
293 Ga0316574_0070821
294 Ga0373924_0026573
295 Ga0373935_0030427
296 Ga0373927_0006378
297 Ga0373927_0008195
298 Ga0373947_0087981
299 Ga0373937_0005678
300 Ga0373925_0005684
301 Ga0373925_0015393
302 Ga0451577_0004315
303 Ga0451577_0024825
304 Ga0453684_0004469
305 Ga0451576_0022730
306 Ga0451576_0028740
307 Ga0451576_0099959
308 Ga0451576_0102942
309 Ga0451576_0250732
310 Ga0451576_0354916
311 Ga0495592_0000180
312 Ga0495629_0118713
313 Ga0495641_0075217
314 Ga0495651_0145919
315 Ga0495582_0032723
316 Ga0495639_0030958
317 Ga0495662_0020755
318 Ga0495664_0022393
319 Ga0495618_0003398
320 Ga0495618_0016798
321 Ga0495628_0000045
322 Ga0495628_0057718
323 Ga0495628_0178776
324 Ga0495630_0000318
325 Ga0495630_0021290
326 Ga0495630_0032756
327 Ga0495630_0101094
328 Ga0495666_0003635
329 Ga0495666_0006565
330 Ga0495652_0021342
331 Ga0495640_0053764
332 Ga0495640_0148689
333 Ga0495586_0000205
334 Ga0495586_0000477
335 Ga0495586_0026911
336 Ga0495586_0040068
337 Ga0495621_0026087
338 Ga0495645_0005972
339 Ga0495645_0007100
340 Ga0495645_0154047
341 Ga0495622_0031096
342 Ga0495667_0072094
343 Ga0495667_0106919
344 Ga0495634_0005142
345 Ga0495635_0099602
346 Ga0495599_0024046
347 Ga0495647_0023822
348 Ga0495658_0006210
349 Ga0495613_0001737
350 Ga0495613_0032010
351 Ga0495624_0066242
352 Ga0495674_0006767
353 Ga0495674_0007990
354 Ga0495674_0123853
355 Ga0495676_0010642
356 Ga0495680_0004846
357 Ga0495684_0105071
358 Ga0495684_0188676
359 Ga0496106_0114697
360 Ga0501032_0009026
361 Ga0501033_0001416
362 Ga0501033_0052102
363 Ga0501043_0027853
364 Ga0501070_0098013
365 Ga0501080_0005576
366 Ga0501035_0019572
367 Ga0501035_0021858
368 Ga0501035_0028355
369 Ga0501044_0000125
370 Ga0501044_0143039
371 nmdc:mga09592_77809_c1
372 nmdc:mga06r32_180724_c1
373 nmdc:mga08y16_112473_c1
374 nmdc:mga08y16_58789_c1
375 nmdc:mga0n895_82333_c1
376 Ga0495601_0184198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

33

238

0.86

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

34

282

0.85

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

29

371

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2plk-assembly1.cif.gz_A crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus 0.8933 18 384
1szr-assembly1.cif.gz_C a dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate 0.8914 26 385
2plk-assembly1.cif.gz_B crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus 0.888 18 384
2plj-assembly1.cif.gz_B crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus 0.8879 18 384
1njj-assembly2.cif.gz_C crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418 0.8841 23 385
ID Description Score Start End Superfamily
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9549 35 289 3.20.20.10
2p3eA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9512 35 289 3.20.20.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9472 35 289 3.20.20.10
2p3eA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9429 35 289 3.20.20.10
4xg1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9354 35 289 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A357M118-F1-model_v4 Diaminopimelate decarboxylase 0.9971 54 132 GO:0006596
GO:0008836
GO:0009089
AF-A0A7V5KT84-F1-model_v4 Diaminopimelate decarboxylase 0.9898 4 154 GO:0008836
GO:0009089
AF-A0A532CP28-F1-model_v4 Orn/DAP/Arg decarboxylase 2 N-terminal domain-containing protein 0.9854 1 99 GO:0008836
GO:0009089
AF-A0A800IF44-F1-model_v4 Diaminopimelate decarboxylase 0.9853 1 154 GO:0006596
GO:0008836
GO:0009089
AF-A0A7C5GQ92-F1-model_v4 Diaminopimelate decarboxylase 0.9849 1 110 GO:0006596
GO:0008836
GO:0009089

Map