F289537

General Info

Members Datasets Scaffolds Average Seq Length
188 144 376 284

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10016642|Ga0207678_100166422
Length 332
Sequence MSVLLGAVAYDPKVVTIWDGFRSWLRESGLDFDYVLYSNYERQVTDLVDGRVDVAWNSPLAWVRARRLAASRGVPLTPVTMRDTDCDLRSVIVVRADSPVRSVSELAGHIVATGAVDSPQATLLPLSLLRAAGLDPAADVAVRRFDIGVGLHGDHIGGERDAARALFAADPADRVDAACMIDSNLLLFGREGTLPAGSVRVLAQTPLYDHCTMTAHGDASPGISRLAGLLLGMDYADAGLRPLLDLEGLKQWRPPRLSGYAQLERAVDEAGFYDADGAVTAAGYRPLWQPWTSPASGLTRAVTCCSPALSPGSPRASGMLVTAAGPARSGPA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
143 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
144 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 2.66
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 5.85
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10016642 3300026067 Bacteria 6460
2 Ga0070658_10110637 3300005327 Bacteria 2275
3 Ga0070676_10064602 3300005328 Bacteria 2183
4 Ga0070683_100085997 3300005329 Bacteria 2948
5 Ga0070683_100130047 3300005329 Bacteria 2383
6 Ga0070683_100339452 3300005329 Unclassified 1430
7 Ga0070680_100146739 3300005336 Bacteria 1980
8 Ga0070680_100441589 3300005336 Bacteria 1111
9 Ga0070682_100118045 3300005337 Bacteria 1777
10 Ga0070682_100147164 3300005337 Unclassified 1612
11 Ga0070660_100029419 3300005339 Bacteria 4117
12 Ga0070691_10048629 3300005341 Bacteria 2019
13 Ga0070661_100249330 3300005344 Bacteria 1370
14 Ga0070692_10040160 3300005345 Bacteria 2392
15 Ga0070668_100038807 3300005347 Bacteria 3642
16 Ga0070675_100195926 3300005354 Bacteria 1752
17 Ga0070714_100007786 3300005435 Bacteria 8345
18 Ga0070714_100052002 3300005435 Bacteria 3494
19 Ga0070714_100408554 3300005435 Bacteria 1284
20 Ga0070713_100041171 3300005436 Bacteria 3762
21 Ga0070713_100270515 3300005436 Bacteria 1556
22 Ga0070713_100279405 3300005436 Bacteria 1531
23 Ga0070710_10002458 3300005437 Bacteria 8776
24 Ga0070708_100206979 3300005445 Bacteria 1838
25 Ga0070678_100387102 3300005456 Bacteria 1211
26 Ga0070662_100447895 3300005457 Bacteria 1071
27 Ga0070681_10064226 3300005458 Bacteria 3642
28 Ga0070681_10296723 3300005458 Bacteria 1526
29 Ga0070706_100040164 3300005467 Bacteria 4319
30 Ga0070707_100030836 3300005468 Bacteria 5107
31 Ga0070698_100010938 3300005471 Bacteria 9653
32 Ga0070679_100014727 3300005530 Bacteria 7515
33 Ga0070679_100118169 3300005530 Bacteria 2636
34 Ga0070684_100101840 3300005535 Bacteria 2567
35 Ga0070684_100516424 3300005535 Bacteria 1107
36 Ga0070665_100016514 3300005548 Bacteria 7401
37 Ga0070665_100211674 3300005548 Bacteria 1939
38 Ga0068857_100114679 3300005577 Bacteria 2423
39 Ga0068852_100284129 3300005616 Bacteria 1596
40 Ga0068864_100286051 3300005618 Bacteria 1540
41 Ga0068863_100013113 3300005841 Bacteria 7996
42 Ga0068860_100037061 3300005843 Bacteria 4669
43 Ga0068862_100557327 3300005844 Bacteria 1095
44 Ga0081539_10005997 3300005985 Bacteria 11944
45 Ga0070712_100086035 3300006175 Bacteria 2290
46 Ga0075428_100022833 3300006844 Bacteria 6923
47 Ga0075428_100087208 3300006844 Bacteria 3404
48 Ga0075428_100442779 3300006844 Bacteria 1392
49 Ga0075430_100073012 3300006846 Bacteria 2877
50 Ga0075431_100087839 3300006847 Bacteria 3208
51 Ga0075431_100092026 3300006847 Bacteria 3129
52 Ga0075431_100107829 3300006847 Bacteria 2874
53 Ga0075429_100078521 3300006880 Bacteria 2877
54 Ga0075429_100335574 3300006880 Bacteria 1323
55 Ga0068865_100193895 3300006881 Bacteria 1573
56 Ga0111539_10070412 3300009094 Bacteria 4129
57 Ga0111539_10300197 3300009094 Bacteria 1869
58 Ga0114129_10001319 3300009147 Bacteria 33177
59 Ga0105243_10445666 3300009148 Unclassified 1213
60 Ga0157370_10038376 3300013104 Bacteria 4633
61 Ga0157369_10011262 3300013105 Bacteria 10160
62 Ga0157369_10065400 3300013105 Bacteria 3913
63 Ga0157375_10079856 3300013308 Unclassified 3308
64 Ga0157375_10279390 3300013308 Bacteria 1833
65 Ga0163163_10196548 3300014325 Bacteria 2065
66 Ga0157379_10011490 3300014968 Bacteria 7729
67 Ga0206354_10820762 3300020081 Bacteria 2428
68 Ga0206353_12063799 3300020082 Bacteria 2122
69 Ga0224712_10011256 3300022467 Bacteria 2769
70 Ga0224712_10131578 3300022467 Bacteria 1093
71 Ga0207699_10002150 3300025906 Bacteria 9316
72 Ga0207645_10068782 3300025907 Bacteria 2264
73 Ga0207705_10022846 3300025909 Bacteria 4459
74 Ga0207684_10146715 3300025910 Bacteria 2030
75 Ga0207707_10013287 3300025912 Bacteria 7176
76 Ga0207693_10052932 3300025915 Bacteria 3185
77 Ga0207693_10068449 3300025915 Bacteria 2779
78 Ga0207693_10219818 3300025915 Bacteria 1493
79 Ga0207652_10079125 3300025921 Bacteria 2871
80 Ga0207646_10027607 3300025922 Bacteria 5174
81 Ga0207694_10276032 3300025924 Bacteria 1379
82 Ga0207700_10006702 3300025928 Bacteria 6989
83 Ga0207700_10010519 3300025928 Bacteria 5844
84 Ga0207664_10095038 3300025929 Bacteria 2451
85 Ga0207664_10533446 3300025929 Bacteria 1052
86 Ga0207644_10001087 3300025931 Bacteria 17443
87 Ga0207665_10150722 3300025939 Bacteria 1665
88 Ga0207661_10111122 3300025944 Bacteria 2318
89 Ga0207661_10298135 3300025944 Bacteria 1445
90 Ga0207667_10165983 3300025949 Bacteria 2270
91 Ga0207668_10118226 3300025972 Bacteria 2002
92 Ga0207678_10044693 3300026067 Bacteria 3831
93 Ga0207676_10078910 3300026095 Bacteria 2668
94 Ga0207674_10049144 3300026116 Bacteria 4315
95 Ga0268264_10003038 3300028381 Bacteria 14549
96 Ga0265337_1001491 3300028556 Bacteria 11472
97 Ga0265326_10007423 3300028558 Bacteria 3363
98 Ga0265319_1001683 3300028563 Bacteria 12776
99 Ga0265334_10000121 3300028573 Bacteria 50668
100 Ga0265318_10034389 3300028577 Bacteria 1954
101 Ga0265323_10005192 3300028653 Bacteria 5540
102 Ga0265322_10002164 3300028654 Bacteria 6112
103 Ga0265336_10001936 3300028666 Bacteria 8903
104 Ga0265338_10000059 3300028800 Bacteria 198047
105 Ga0265324_10004851 3300029957 Bacteria 5931
106 Ga0265332_10002481 3300031238 Bacteria 9393
107 Ga0265320_10018517 3300031240 Bacteria 3831
108 Ga0265325_10002259 3300031241 Bacteria 13056
109 Ga0265339_10040332 3300031249 Bacteria 2595
110 Ga0265313_10004322 3300031595 Bacteria 10996
111 Ga0265314_10019302 3300031711 Bacteria 5284
112 Ga0307415_100197241 3300032126 Bacteria 1594
113 Ga0316212_1003270 3300033547 Bacteria 2333
114 Ga0373923_0003156 3300035111 Bacteria 5236
115 Ga0373936_0130717 3300035113 Bacteria 1079
116 Ga0373935_0170824 3300035692 Bacteria 1487
117 Ga0373927_0319336 3300035695 Bacteria 1023
118 Ga0373947_0030473 3300035725 Bacteria 3170
119 Ga0373937_0451887 3300036401 Bacteria 1220
120 Ga0372808_009457 3300036459 Bacteria 1362
121 Ga0373925_0000177 3300037068 Bacteria 69605
122 Ga0436364_0383738 3300037853 Bacteria 5877
123 Ga0436364_0551974 3300037853 Bacteria 1695
124 Ga0436364_0874773 3300037853 Bacteria 1627
125 Ga0436364_1079248 3300037853 Bacteria 1168
126 Ga0436360_1196039 3300039438 Bacteria 3299
127 Ga0436362_1300922 3300039453 Bacteria 3118
128 Ga0466961_0156865 3300044693 Bacteria 1420
129 Ga0466959_0085824 3300045049 Bacteria 2265
130 Ga0466958_0156847 3300045836 Bacteria 1437
131 Ga0466967_0110690 3300045976 Bacteria 2523
132 Ga0466967_0211999 3300045976 Bacteria 1837
133 Ga0466967_0609871 3300045976 Bacteria 1078
134 Ga0495629_0163897 3300046459 Unclassified 1544
135 Ga0495653_0118399 3300046463 Bacteria 1891
136 Ga0495580_0099364 3300046472 Bacteria 2024
137 Ga0495582_0024103 3300046473 Bacteria 3328
138 Ga0495639_0052634 3300046475 Bacteria 1854
139 Ga0495662_0179852 3300046476 Bacteria 1042
140 Ga0495618_0154587 3300046514 Bacteria 1464
141 Ga0495628_0027830 3300046516 Bacteria 4595
142 Ga0495652_0195661 3300046529 Bacteria 1539
143 Ga0495634_0015528 3300046642 Bacteria 5467
144 Ga0495634_0027691 3300046642 Unclassified 3942
145 Ga0495635_0072142 3300046663 Bacteria 2366
146 Ga0495604_0103324 3300047317 Bacteria 2091
147 Ga0495676_0214252 3300047321 Bacteria 1331
148 Ga0495680_0070966 3300047322 Bacteria 2653
149 Ga0495602_0066556 3300048088 Bacteria 3103
150 Ga0496101_0084486 3300048904 Bacteria 2351
151 Ga0496101_0157949 3300048904 Bacteria 1738
152 Ga0496102_0000328 3300048905 Bacteria 59218
153 Ga0496103_0000061 3300048906 Bacteria 136265
154 Ga0496104_0011825 3300048907 Bacteria 7832
155 Ga0496104_0037832 3300048907 Bacteria 4512
156 Ga0496104_0248597 3300048907 Bacteria 1691
157 Ga0496109_0061143 3300048912 Bacteria 3443
158 Ga0496109_0420334 3300048912 Bacteria 1263
159 Ga0496112_0337376 3300048915 Bacteria 1451
160 Ga0496115_0115613 3300048918 Bacteria 2206
161 Ga0496116_0000264 3300048919 Bacteria 91654
162 Ga0496117_0000080 3300048920 Bacteria 226550
163 Ga0496118_0000239 3300048921 Bacteria 96914
164 Ga0496119_0007512 3300048922 Bacteria 9799
165 Ga0496119_0014270 3300048922 Bacteria 6236
166 Ga0496120_0133855 3300048923 Bacteria 1266
167 Ga0496121_0140844 3300048924 Bacteria 1790
168 Ga0496124_0040276 3300048927 Bacteria 4044
169 Ga0496126_0000039 3300048929 Bacteria 347353
170 Ga0496126_0001841 3300048929 Bacteria 30940
171 Ga0496126_0030408 3300048929 Bacteria 5116
172 Ga0496126_0201292 3300048929 Bacteria 1681
173 Ga0501040_0082476 3300049576 Bacteria 2229
174 nmdc:mga05p37_15812_c1 3300050507 Bacteria 9075
175 nmdc:mga09592_218_c1 3300050508 Bacteria 41157
176 nmdc:mga09592_535680_c1 3300050508 Bacteria 1006
177 nmdc:mga09592_69251_c1 3300050508 Bacteria 2993
178 nmdc:mga0qj67_13_c1 3300050509 Bacteria 32992
179 nmdc:mga06r32_507_c1 3300050510 Bacteria 33532
180 nmdc:mga06r32_51933_c1 3300050510 Bacteria 3925
181 nmdc:mga08y16_13507_c2 3300050511 Bacteria 6558
182 Ga0495601_0360576 3300053077 Bacteria 945
183 Ga0495619_0410681 3300053085 Bacteria 934
184 Ga0500566_0113067 3300053094 Bacteria 1474
185 Ga0501084_0021159 3300054114 Bacteria 5424
186 2731905819 2731639228 Bacteria 4187555
187 2795781867 2795385470 Bacteria 8317180
188 2947229409 2947224130 Bacteria 9938529
189 Ga0207678_10016642
190 Ga0070658_10110637
191 Ga0070676_10064602
192 Ga0070683_100085997
193 Ga0070683_100130047
194 Ga0070683_100339452
195 Ga0070680_100146739
196 Ga0070680_100441589
197 Ga0070682_100118045
198 Ga0070682_100147164
199 Ga0070660_100029419
200 Ga0070691_10048629
201 Ga0070661_100249330
202 Ga0070692_10040160
203 Ga0070668_100038807
204 Ga0070675_100195926
205 Ga0070714_100007786
206 Ga0070714_100052002
207 Ga0070714_100408554
208 Ga0070713_100041171
209 Ga0070713_100270515
210 Ga0070713_100279405
211 Ga0070710_10002458
212 Ga0070708_100206979
213 Ga0070678_100387102
214 Ga0070662_100447895
215 Ga0070681_10064226
216 Ga0070681_10296723
217 Ga0070706_100040164
218 Ga0070707_100030836
219 Ga0070698_100010938
220 Ga0070679_100014727
221 Ga0070679_100118169
222 Ga0070684_100101840
223 Ga0070684_100516424
224 Ga0070665_100016514
225 Ga0070665_100211674
226 Ga0068857_100114679
227 Ga0068852_100284129
228 Ga0068864_100286051
229 Ga0068863_100013113
230 Ga0068860_100037061
231 Ga0068862_100557327
232 Ga0081539_10005997
233 Ga0070712_100086035
234 Ga0075428_100022833
235 Ga0075428_100087208
236 Ga0075428_100442779
237 Ga0075430_100073012
238 Ga0075431_100087839
239 Ga0075431_100092026
240 Ga0075431_100107829
241 Ga0075429_100078521
242 Ga0075429_100335574
243 Ga0068865_100193895
244 Ga0111539_10070412
245 Ga0111539_10300197
246 Ga0114129_10001319
247 Ga0105243_10445666
248 Ga0157370_10038376
249 Ga0157369_10011262
250 Ga0157369_10065400
251 Ga0157375_10079856
252 Ga0157375_10279390
253 Ga0163163_10196548
254 Ga0157379_10011490
255 Ga0206354_10820762
256 Ga0206353_12063799
257 Ga0224712_10011256
258 Ga0224712_10131578
259 Ga0207699_10002150
260 Ga0207645_10068782
261 Ga0207705_10022846
262 Ga0207684_10146715
263 Ga0207707_10013287
264 Ga0207693_10052932
265 Ga0207693_10068449
266 Ga0207693_10219818
267 Ga0207652_10079125
268 Ga0207646_10027607
269 Ga0207694_10276032
270 Ga0207700_10006702
271 Ga0207700_10010519
272 Ga0207664_10095038
273 Ga0207664_10533446
274 Ga0207644_10001087
275 Ga0207665_10150722
276 Ga0207661_10111122
277 Ga0207661_10298135
278 Ga0207667_10165983
279 Ga0207668_10118226
280 Ga0207678_10044693
281 Ga0207676_10078910
282 Ga0207674_10049144
283 Ga0268264_10003038
284 Ga0265337_1001491
285 Ga0265326_10007423
286 Ga0265319_1001683
287 Ga0265334_10000121
288 Ga0265318_10034389
289 Ga0265323_10005192
290 Ga0265322_10002164
291 Ga0265336_10001936
292 Ga0265338_10000059
293 Ga0265324_10004851
294 Ga0265332_10002481
295 Ga0265320_10018517
296 Ga0265325_10002259
297 Ga0265339_10040332
298 Ga0265313_10004322
299 Ga0265314_10019302
300 Ga0307415_100197241
301 Ga0316212_1003270
302 Ga0373923_0003156
303 Ga0373936_0130717
304 Ga0373935_0170824
305 Ga0373927_0319336
306 Ga0373947_0030473
307 Ga0373937_0451887
308 Ga0372808_009457
309 Ga0373925_0000177
310 Ga0436364_0383738
311 Ga0436364_0551974
312 Ga0436364_0874773
313 Ga0436364_1079248
314 Ga0436360_1196039
315 Ga0436362_1300922
316 Ga0466961_0156865
317 Ga0466959_0085824
318 Ga0466958_0156847
319 Ga0466967_0110690
320 Ga0466967_0211999
321 Ga0466967_0609871
322 Ga0495629_0163897
323 Ga0495653_0118399
324 Ga0495580_0099364
325 Ga0495582_0024103
326 Ga0495639_0052634
327 Ga0495662_0179852
328 Ga0495618_0154587
329 Ga0495628_0027830
330 Ga0495652_0195661
331 Ga0495634_0015528
332 Ga0495634_0027691
333 Ga0495635_0072142
334 Ga0495604_0103324
335 Ga0495676_0214252
336 Ga0495680_0070966
337 Ga0495602_0066556
338 Ga0496101_0084486
339 Ga0496101_0157949
340 Ga0496102_0000328
341 Ga0496103_0000061
342 Ga0496104_0011825
343 Ga0496104_0037832
344 Ga0496104_0248597
345 Ga0496109_0061143
346 Ga0496109_0420334
347 Ga0496112_0337376
348 Ga0496115_0115613
349 Ga0496116_0000264
350 Ga0496117_0000080
351 Ga0496118_0000239
352 Ga0496119_0007512
353 Ga0496119_0014270
354 Ga0496120_0133855
355 Ga0496121_0140844
356 Ga0496124_0040276
357 Ga0496126_0000039
358 Ga0496126_0001841
359 Ga0496126_0030408
360 Ga0496126_0201292
361 Ga0501040_0082476
362 nmdc:mga05p37_15812_c1
363 nmdc:mga09592_218_c1
364 nmdc:mga09592_535680_c1
365 nmdc:mga09592_69251_c1
366 nmdc:mga0qj67_13_c1
367 nmdc:mga06r32_507_c1
368 nmdc:mga06r32_51933_c1
369 nmdc:mga08y16_13507_c2
370 Ga0495601_0360576
371 Ga0495619_0410681
372 Ga0500566_0113067
373 Ga0501084_0021159
374 2731905819
375 2795781867
376 2947229409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

7

260

0.86

PF09084

NMT1

NMT1/THI5 like

21

153

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o2k-assembly4.cif.gz_C native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution 0.7948 3 267
6ghq-assembly1.cif.gz_A htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution 0.7919 3 267
3tfl-assembly1.cif.gz_A lytr-cps2a-psr family protein with bound octaprenyl pyrophosphate lipid 0.7909 86 201
5o2k-assembly4.cif.gz_C native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution 0.7701 3 267
6x8w-assembly1.cif.gz_A structure of arrx y138a mutant protein bound to sulfate from chrysiogenes arsenatis 0.7627 3 265
ID Description Score Start End Superfamily
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9008 88 201 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8542 88 201 3.40.190.10
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8539 82 186 3.40.190.10
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8387 82 186 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7934 76 201 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X0CCG2-F1-model_v4 ABC-type phosphate/phosphonate transport system substrate-binding protein 0.9673 1 282
AF-A0A1F8QLP8-F1-model_v4 Radical SAM core domain-containing protein 0.9646 2 281 GO:0003824
GO:0046872
GO:0051536
AF-A0A7X0CCG2-F1-model_v4 ABC-type phosphate/phosphonate transport system substrate-binding protein 0.964 1 282
AF-A0A6J7Q3I0-F1-model_v4 Unannotated protein 0.9639 2 279
AF-A0A849Z6Y8-F1-model_v4 PhnD/SsuA/transferrin family substrate-binding protein 0.963 34 265

Map