F289315

General Info

Members Datasets Scaffolds Average Seq Length
188 167 376 201

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10089606|Ga0105237_100896061
Length 214
Sequence MTIWRLAPHARDGILVADLRRVGDNMLLPDGYSDIPPGKIAAVVTHLEMRERPAPLPDPPGAWALRRVEAPGLDWYRDHYRRIGEEWLWSSRLAMSDVELAAIIHSPRVDRDEGLLELDFREPSQCELVFFGVTAKLIGSSAGRFLMNRALQRAWSQPISRLWVHTCSFDHPNALAFYQRAGFRPFRRQVEVSDDPRLDGTLPRDVARHVPIVE

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
115 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
116 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
120 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
121 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
122 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
123 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
124 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
125 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
126 2791355199
127 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
128 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
129 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
130 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
131 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
132 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
133 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
134 2909042592 Labrys sp. LIt4 Isolate Nodule
135 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
136 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
137 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
138 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
139 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
140 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
141 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
142 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
143 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
144 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
145 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
146 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
147 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
148 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
152 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
153 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
154 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
155 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
156 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
157 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
158 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
159 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
160 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
161 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
162 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
163 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
164 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
165 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
166 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
167 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.8
Metatranscriptomes 0.53
Isolates 25.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 23.4
Rhizoplane 1.06
Rhizosphere 58.51
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10089606 3300009545 Bacteria 3065
2 rootL2_10333648 3300003322 Bacteria 1471
3 Ga0065715_10226408 3300005293 Bacteria 1225
4 Ga0070658_10213501 3300005327 Bacteria 1630
5 Ga0070680_100043590 3300005336 Bacteria 3645
6 Ga0070682_100428049 3300005337 Bacteria 1008
7 Ga0070669_100817267 3300005353 Bacteria 793
8 Ga0070674_100545678 3300005356 Bacteria 972
9 Ga0070681_10077512 3300005458 Bacteria 3281
10 Ga0068853_100280673 3300005539 Bacteria 1536
11 Ga0070672_100433053 3300005543 Bacteria 1131
12 Ga0070665_100523266 3300005548 Bacteria 1198
13 Ga0068855_100052945 3300005563 Bacteria 4777
14 Ga0068855_100547355 3300005563 Bacteria 1253
15 Ga0070664_100082630 3300005564 Bacteria 2770
16 Ga0068854_100272312 3300005578 Bacteria 1360
17 Ga0068852_100015210 3300005616 Bacteria 5957
18 Ga0068852_100081366 3300005616 Bacteria 2874
19 Ga0068852_101111305 3300005616 Bacteria 811
20 Ga0068860_100005762 3300005843 Bacteria 12491
21 Ga0081455_10042064 3300005937 Bacteria 4012
22 Ga0070717_10003791 3300006028 Bacteria 10866
23 Ga0075432_10078543 3300006058 Bacteria 1194
24 Ga0070716_100464291 3300006173 Bacteria 926
25 Ga0075369_10026301 3300006186 Bacteria 2424
26 Ga0075434_100382700 3300006871 Bacteria 1428
27 Ga0105240_10877037 3300009093 Bacteria 967
28 Ga0111539_10281345 3300009094 Bacteria 1936
29 Ga0111539_10759685 3300009094 Bacteria 1128
30 Ga0105237_11630525 3300009545 Bacteria 652
31 Ga0105238_10122534 3300009551 Bacteria 2579
32 Ga0105249_10820304 3300009553 Bacteria 995
33 Ga0105239_10090865 3300010375 Bacteria 3368
34 Ga0105239_10171516 3300010375 Bacteria 2426
35 Ga0105239_10406160 3300010375 Bacteria 1542
36 Ga0105239_11099315 3300010375 Bacteria 915
37 Ga0157370_10031109 3300013104 Bacteria 5224
38 Ga0157374_11244466 3300013296 Bacteria 766
39 Ga0157372_10546586 3300013307 Bacteria 1350
40 Ga0182008_10072927 3300014497 Bacteria 1689
41 Ga0163161_10132367 3300017792 Bacteria 1882
42 Ga0206356_11173527 3300020070 Bacteria 2079
43 Ga0209677_100599 3300025253 Bacteria 19507
44 Ga0209233_1003339 3300025261 Bacteria 5679
45 Ga0209455_1009913 3300025272 Bacteria 2461
46 Ga0209758_1020617 3300025297 Bacteria 3109
47 Ga0207647_10163342 3300025904 Bacteria 1298
48 Ga0207699_10424866 3300025906 Bacteria 950
49 Ga0207643_10213158 3300025908 Bacteria 1179
50 Ga0207654_10333201 3300025911 Bacteria 1041
51 Ga0207671_10008773 3300025914 Bacteria 8516
52 Ga0207660_10323585 3300025917 Bacteria 1232
53 Ga0207649_10079084 3300025920 Bacteria 2123
54 Ga0207709_10481135 3300025935 Bacteria 965
55 Ga0207691_10110703 3300025940 Bacteria 2442
56 Ga0207661_10080726 3300025944 Bacteria 2684
57 Ga0207679_10237579 3300025945 Bacteria 1542
58 Ga0207679_10679688 3300025945 Bacteria 933
59 Ga0207667_10096842 3300025949 Bacteria 3045
60 Ga0207712_10309426 3300025961 Bacteria 1299
61 Ga0207640_10165494 3300025981 Bacteria 1641
62 Ga0207639_10093213 3300026041 Bacteria 2415
63 Ga0207678_10022740 3300026067 Bacteria 5490
64 Ga0207702_10105370 3300026078 Bacteria 2497
65 Ga0207674_10489121 3300026116 Bacteria 1189
66 Ga0207683_10197713 3300026121 Bacteria 1827
67 Ga0207428_10078554 3300027907 Bacteria 2582
68 Ga0268266_10294892 3300028379 Bacteria 1511
69 Ga0268266_10370007 3300028379 Bacteria 1350
70 Ga0268264_10000537 3300028381 Bacteria 48029
71 Ga0265337_1004941 3300028556 Bacteria 5425
72 Ga0265319_1008460 3300028563 Bacteria 4505
73 Ga0265334_10005308 3300028573 Bacteria 5633
74 Ga0265318_10003981 3300028577 Bacteria 7270
75 Ga0265323_10007829 3300028653 Bacteria 4418
76 Ga0265336_10000346 3300028666 Bacteria 30553
77 Ga0265338_10000417 3300028800 Bacteria 76249
78 Ga0265324_10002180 3300029957 Bacteria 10252
79 Ga0307513_10059822 3300031456 Bacteria 4042
80 Ga0307508_10235717 3300031616 Bacteria 1428
81 Ga0307516_10007717 3300031730 Bacteria 12308
82 Ga0307416_100312370 3300032002 Bacteria 1569
83 Ga0307510_10239736 3300033180 Bacteria 1309
84 Ga0373943_0074127 3300035170 Bacteria 1730
85 Ga0373927_0368017 3300035695 Bacteria 948
86 Ga0373947_0258501 3300035725 Bacteria 1153
87 Ga0395899_0012880 3300037312 Bacteria 6403
88 Ga0395899_0084828 3300037312 Bacteria 2302
89 Ga0395900_0002013 3300037418 Bacteria 22906
90 Ga0395900_0335208 3300037418 Bacteria 1489
91 Ga0395901_0002160 3300038443 Bacteria 20081
92 Ga0395901_0016353 3300038443 Bacteria 7554
93 Ga0439453_0000427 3300041408 Bacteria 4566
94 Ga0451853_1148372 3300041512 Bacteria 640
95 Ga0439448_0052190 3300042005 Bacteria 1340
96 Ga0439435_0102650 3300042436 Bacteria 880
97 Ga0439464_0114278 3300042439 Bacteria 828
98 Ga0439440_0083478 3300042993 Bacteria 848
99 Ga0466968_0002228 3300044735 Bacteria 7086
100 Ga0466957_0008214 3300044842 Bacteria 5929
101 Ga0466967_0157732 3300045976 Bacteria 2127
102 Ga0495584_0198192 3300046491 Bacteria 1021
103 Ga0495585_0136938 3300046492 Bacteria 1285
104 Ga0495607_0060615 3300046501 Bacteria 2153
105 Ga0495623_0457094 3300046679 Bacteria 679
106 Ga0495581_0173915 3300047315 Bacteria 1259
107 Ga0495636_0134476 3300047318 Bacteria 1101
108 Ga0495672_0074385 3300047320 Bacteria 1913
109 Ga0496106_0004208 3300048909 Bacteria 10726
110 Ga0496112_0596825 3300048915 Bacteria 1036
111 Ga0496116_0195564 3300048919 Bacteria 1065
112 Ga0496117_0036430 3300048920 Bacteria 3681
113 Ga0496117_0132978 3300048920 Bacteria 1504
114 Ga0496118_0015457 3300048921 Bacteria 7064
115 Ga0496118_0267626 3300048921 Bacteria 960
116 Ga0496121_0002004 3300048924 Bacteria 32342
117 Ga0496121_0049540 3300048924 Bacteria 3561
118 Ga0496121_0053724 3300048924 Bacteria 3373
119 Ga0496122_0427644 3300048925 Bacteria 664
120 Ga0496124_0007065 3300048927 Bacteria 12028
121 Ga0496125_0052727 3300048928 Bacteria 3343
122 Ga0496126_0013586 3300048929 Bacteria 8269
123 Ga0496126_0601371 3300048929 Bacteria 866
124 Ga0496126_0967816 3300048929 Bacteria 641
125 Ga0501034_0571666 3300049571 Bacteria 1038
126 Ga0501070_0072130 3300049586 Bacteria 2859
127 Ga0501073_0204591 3300049589 Bacteria 1365
128 Ga0501083_0060682 3300049744 Bacteria 2526
129 nmdc:mga0yw44_239839_c1 3300050492 Bacteria 1205
130 nmdc:mga08y16_1076988_c1 3300050511 Bacteria 780
131 nmdc:mga08y16_88220_c1 3300050511 Bacteria 3232
132 nmdc:mga0n895_189367_c1 3300050512 Bacteria 2088
133 nmdc:mga08x19_18614_c1 3300050514 Bacteria 4256
134 Ga0500572_001972 3300053111 Bacteria 5137
135 Ga0500642_0000183 3300053130 Bacteria 25867
136 Ga0500657_123985 3300053728 Bacteria 1017
137 Ga0501084_0660209 3300054114 Unclassified 883
138 Ga0501082_0004193 3300060353 Bacteria 12597
139 Ga0501082_0128451 3300060353 Bacteria 2199
140 2507505926 2507262055 Bacteria 8048963
141 2508540117 2508501009 Bacteria 7784016
142 2508696189 2508501042 Bacteria 8719808
143 2513716100 2513237104 Bacteria 10034502
144 2515628531 2515154112 Bacteria 8294334
145 2723842282 2721755755 Bacteria 8322773
146 2728749186 2728368998 Bacteria 8720350
147 2793084096
148 2874596336 2874590934 Bacteria 8299676
149 2874650324 2874645413 Bacteria 8214782
150 2876776801 2876771140 Bacteria 8287509
151 2876824591 2876818435 Bacteria 8274608
152 2879080938 2879074833 Bacteria 8279565
153 2889306852 2889306138 Bacteria 6358934
154 2902411541 2902405164 Bacteria 6784948
155 2909045833 2909042592 Bacteria 6499737
156 2922366719 2922361189 Bacteria 7436256
157 2928128671 2928125067 Bacteria 5937560
158 2935614350 2935608549 Bacteria 8203142
159 2935649380 2935648319 Bacteria 8801166
160 2935657848 2935656913 Bacteria 8965014
161 2935826568 2935819856 Bacteria 8261050
162 2935851138 2935847175 Bacteria 8228321
163 2935913187 2935908558 Bacteria 8568796
164 2935922609 2935916978 Bacteria 9113783
165 2935930888 2935926038 Bacteria 8601059
166 2935939778 2935934488 Bacteria 8602579
167 2935946727 2935942939 Bacteria 8599779
168 2935956072 2935951376 Bacteria 8602333
169 2935972865 2935967501 Bacteria 8603075
170 2935978219 2935975950 Bacteria 8347125
171 2935985656 2935984226 Bacteria 8302647
172 2936012067 2936011229 Bacteria 8801034
173 2936020852 2936019824 Bacteria 8804134
174 2936029360 2936028420 Bacteria 8965941
175 2936048316 2936046547 Bacteria 8903709
176 2936056573 2936055302 Bacteria 8785755
177 8006966313 8006964411 Bacteria 8966052
178 8006996983 8006994254 Bacteria 8309700
179 8016634882 8016630954 Bacteria 9217207
180 8019621961 8019619141 Bacteria 9218857
181 8019631361 8019629233 Bacteria 8687553
182 8019639254 8019638758 Bacteria 9062356
183 8019668166 8019659431 Bacteria 8577854
184 8019677629 8019668869 Bacteria 8791617
185 8019687316 8019678201 Bacteria 8863603
186 8019693297 8019687851 Bacteria 8712826
187 8055091316 8055087960 Bacteria 4784273
188 8056678168 8056673599 Bacteria 7871253
189 Ga0105237_10089606
190 rootL2_10333648
191 Ga0065715_10226408
192 Ga0070658_10213501
193 Ga0070680_100043590
194 Ga0070682_100428049
195 Ga0070669_100817267
196 Ga0070674_100545678
197 Ga0070681_10077512
198 Ga0068853_100280673
199 Ga0070672_100433053
200 Ga0070665_100523266
201 Ga0068855_100052945
202 Ga0068855_100547355
203 Ga0070664_100082630
204 Ga0068854_100272312
205 Ga0068852_100015210
206 Ga0068852_100081366
207 Ga0068852_101111305
208 Ga0068860_100005762
209 Ga0081455_10042064
210 Ga0070717_10003791
211 Ga0075432_10078543
212 Ga0070716_100464291
213 Ga0075369_10026301
214 Ga0075434_100382700
215 Ga0105240_10877037
216 Ga0111539_10281345
217 Ga0111539_10759685
218 Ga0105237_11630525
219 Ga0105238_10122534
220 Ga0105249_10820304
221 Ga0105239_10090865
222 Ga0105239_10171516
223 Ga0105239_10406160
224 Ga0105239_11099315
225 Ga0157370_10031109
226 Ga0157374_11244466
227 Ga0157372_10546586
228 Ga0182008_10072927
229 Ga0163161_10132367
230 Ga0206356_11173527
231 Ga0209677_100599
232 Ga0209233_1003339
233 Ga0209455_1009913
234 Ga0209758_1020617
235 Ga0207647_10163342
236 Ga0207699_10424866
237 Ga0207643_10213158
238 Ga0207654_10333201
239 Ga0207671_10008773
240 Ga0207660_10323585
241 Ga0207649_10079084
242 Ga0207709_10481135
243 Ga0207691_10110703
244 Ga0207661_10080726
245 Ga0207679_10237579
246 Ga0207679_10679688
247 Ga0207667_10096842
248 Ga0207712_10309426
249 Ga0207640_10165494
250 Ga0207639_10093213
251 Ga0207678_10022740
252 Ga0207702_10105370
253 Ga0207674_10489121
254 Ga0207683_10197713
255 Ga0207428_10078554
256 Ga0268266_10294892
257 Ga0268266_10370007
258 Ga0268264_10000537
259 Ga0265337_1004941
260 Ga0265319_1008460
261 Ga0265334_10005308
262 Ga0265318_10003981
263 Ga0265323_10007829
264 Ga0265336_10000346
265 Ga0265338_10000417
266 Ga0265324_10002180
267 Ga0307513_10059822
268 Ga0307508_10235717
269 Ga0307516_10007717
270 Ga0307416_100312370
271 Ga0307510_10239736
272 Ga0373943_0074127
273 Ga0373927_0368017
274 Ga0373947_0258501
275 Ga0395899_0012880
276 Ga0395899_0084828
277 Ga0395900_0002013
278 Ga0395900_0335208
279 Ga0395901_0002160
280 Ga0395901_0016353
281 Ga0439453_0000427
282 Ga0451853_1148372
283 Ga0439448_0052190
284 Ga0439435_0102650
285 Ga0439464_0114278
286 Ga0439440_0083478
287 Ga0466968_0002228
288 Ga0466957_0008214
289 Ga0466967_0157732
290 Ga0495584_0198192
291 Ga0495585_0136938
292 Ga0495607_0060615
293 Ga0495623_0457094
294 Ga0495581_0173915
295 Ga0495636_0134476
296 Ga0495672_0074385
297 Ga0496106_0004208
298 Ga0496112_0596825
299 Ga0496116_0195564
300 Ga0496117_0036430
301 Ga0496117_0132978
302 Ga0496118_0015457
303 Ga0496118_0267626
304 Ga0496121_0002004
305 Ga0496121_0049540
306 Ga0496121_0053724
307 Ga0496122_0427644
308 Ga0496124_0007065
309 Ga0496125_0052727
310 Ga0496126_0013586
311 Ga0496126_0601371
312 Ga0496126_0967816
313 Ga0501034_0571666
314 Ga0501070_0072130
315 Ga0501073_0204591
316 Ga0501083_0060682
317 nmdc:mga0yw44_239839_c1
318 nmdc:mga08y16_1076988_c1
319 nmdc:mga08y16_88220_c1
320 nmdc:mga0n895_189367_c1
321 nmdc:mga08x19_18614_c1
322 Ga0500572_001972
323 Ga0500642_0000183
324 Ga0500657_123985
325 Ga0501084_0660209
326 Ga0501082_0004193
327 Ga0501082_0128451
328 2507505926
329 2508540117
330 2508696189
331 2513716100
332 2515628531
333 2723842282
334 2728749186
335 2793084096
336 2874596336
337 2874650324
338 2876776801
339 2876824591
340 2879080938
341 2889306852
342 2902411541
343 2909045833
344 2922366719
345 2928128671
346 2935614350
347 2935649380
348 2935657848
349 2935826568
350 2935851138
351 2935913187
352 2935922609
353 2935930888
354 2935939778
355 2935946727
356 2935956072
357 2935972865
358 2935978219
359 2935985656
360 2936012067
361 2936020852
362 2936029360
363 2936048316
364 2936056573
365 8006966313
366 8006996983
367 8016634882
368 8019621961
369 8019631361
370 8019639254
371 8019668166
372 8019677629
373 8019687316
374 8019693297
375 8055091316
376 8056678168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

57

183

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.863 83 167
1y9k-assembly3.cif.gz_C iaa acetyltransferase from bacillus cereus atcc 14579 0.8616 38 170
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8606 81 167
6ao7-assembly1.cif.gz_A-2 crystal structure of a gnat family acetyltransferase from elizabethkingia anophelis with acetyl-coa bound 0.8314 35 170
7wx6-assembly1.cif.gz_A a legionella acetyltransferase vipf 0.8313 13 176
ID Description Score Start End Superfamily
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8703 81 170 3.40.630.30
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8559 82 147 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8463 82 165 3.40.630.30
6ao7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8314 35 170 3.40.630.30
af_O17731_1_160_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8296 38 167 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A401TN76-F1-model_v4 N-acetyltransferase domain-containing protein 0.9881 41 196 GO:0016747
AF-A0A6L8A1I3-F1-model_v4 GNAT family N-acetyltransferase 0.9814 46 185 GO:0016747
AF-A0A3B9BIT8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9814 38 170 GO:0016747
AF-A0A4R5UP48-F1-model_v4 GNAT family N-acetyltransferase 0.9805 1 197 GO:0016747
AF-A0A2W4BIC3-F1-model_v4 deleted 0.9775 1 197

Map