F289230

General Info

Members Datasets Scaffolds Average Seq Length
188 151 376 291

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10091258|Ga0105240_100912581
Length 329
Sequence MSKLRWETRVQILTMLCEGSSMRSVSRITGVSINTVSKLLIDAGLACAAFHDKTVRGVTAKSIQADEIWSFSYAKQKNVKFAKAAPEAAGDVWTWTAIDADSKLIVSWHVGDRSQHTGIAFMGDLKARLANRVQLTTDGHQAYLKAVAVVDFDADYAMLNRIFATDYAGAGRYSPPKCIGAVKQAIMGNPDPDLINTSFAERQNLTMRMSMRRFTRLTNAFSKKFENHCHALALYFFFYNFCRVHKTLGATPAMASGLVDHVLKMEDLAALIDKRTAPTLRGPYNRDFKLRHYRSAVDDLVDKSGDKRWISRGAIIPRFRVRCWRIAPE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
84 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
105 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
106 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
107 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
108 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
111 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
112 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
115 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
117 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
118 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
119 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
120 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
121 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
122 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
123 2643221651 Afipia sp. Root123D2 Isolate Unclassified
124 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
125 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
126 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
127 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
128 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
129 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
130 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
131 2904699407
132 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
133 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
134 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
135 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
136 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
139 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
140 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
141 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
142 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
143 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
144 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
145 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
146 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
147 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
148 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
149 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
150 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
151 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 0
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 12.77
Rhizoplane 0.53
Rhizosphere 65.96
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10091258 3300009093 Bacteria 3722
2 JGI24740J21852_10049998 3300001979 Bacteria 1204
3 JGI24739J22299_10011722 3300001989 Bacteria 3231
4 JGI24737J22298_10006519 3300001990 Bacteria 3984
5 JGI25406J46586_10000417 3300003203 Bacteria 19537
6 JGI25406J46586_10001871 3300003203 Bacteria 9887
7 rootL2_10097056 3300003322 Bacteria 2748
8 Ga0065707_10006010 3300005295 Bacteria 2927
9 Ga0065707_10085001 3300005295 Bacteria 6557
10 Ga0070658_10082321 3300005327 Bacteria 2645
11 Ga0070658_10249111 3300005327 Bacteria 1507
12 Ga0070660_100529418 3300005339 Bacteria 982
13 Ga0070689_100188503 3300005340 Bacteria 1678
14 Ga0070689_100327743 3300005340 Bacteria 1280
15 Ga0070661_100274989 3300005344 Bacteria 1305
16 Ga0070669_100001576 3300005353 Bacteria 16524
17 Ga0070667_100033001 3300005367 Bacteria 4322
18 Ga0070708_100000923 3300005445 Bacteria 22230
19 Ga0070706_100024054 3300005467 Bacteria 5609
20 Ga0070698_100519467 3300005471 Bacteria 1129
21 Ga0070679_100017940 3300005530 Bacteria 6857
22 Ga0070696_100024872 3300005546 Bacteria 4069
23 Ga0068855_100193070 3300005563 Bacteria 2295
24 Ga0068854_100090727 3300005578 Bacteria 2273
25 Ga0068856_100035287 3300005614 Bacteria 4900
26 Ga0068852_100150293 3300005616 Bacteria 2165
27 Ga0068851_10009624 3300005834 Bacteria 4499
28 Ga0068862_100229398 3300005844 Bacteria 1684
29 Ga0081455_10003214 3300005937 Bacteria 18916
30 Ga0081455_10039094 3300005937 Bacteria 4196
31 Ga0081539_10000059 3300005985 Bacteria 254888
32 Ga0081539_10000748 3300005985 Bacteria 64594
33 Ga0081539_10011707 3300005985 Bacteria 6889
34 Ga0075368_10012721 3300006042 Bacteria 3083
35 Ga0075367_10009591 3300006178 Bacteria 5067
36 Ga0075434_100047630 3300006871 Bacteria 4254
37 Ga0075435_100134509 3300007076 Bacteria 2070
38 Ga0114129_10668885 3300009147 Bacteria 1338
39 Ga0105241_10000538 3300009174 Bacteria 28546
40 Ga0105242_10009331 3300009176 Bacteria 7534
41 Ga0105237_10008882 3300009545 Bacteria 10830
42 Ga0105238_10051094 3300009551 Bacteria 4159
43 Ga0105238_10056569 3300009551 Bacteria 3935
44 Ga0105238_10076919 3300009551 Viruses 3330
45 Ga0105239_10001114 3300010375 Bacteria 37064
46 Ga0105239_10025796 3300010375 Bacteria 6472
47 Ga0105239_10649911 3300010375 Bacteria 1204
48 Ga0157371_10030014 3300013102 Bacteria 3924
49 Ga0157371_10075861 3300013102 Bacteria 2381
50 Ga0157369_10012487 3300013105 Bacteria 9637
51 Ga0157374_10006457 3300013296 Bacteria 9956
52 Ga0157374_10399533 3300013296 Bacteria 1371
53 Ga0157380_10101525 3300014326 Bacteria 2397
54 Ga0182008_10062351 3300014497 Bacteria 1838
55 Ga0157377_10005455 3300014745 Bacteria 5978
56 Ga0213873_10000012 3300021358 Bacteria 210531
57 Ga0213876_10000021 3300021384 Bacteria 260105
58 Ga0213875_10063281 3300021388 Bacteria 1730
59 Ga0207647_10002932 3300025904 Bacteria 12846
60 Ga0207705_10012899 3300025909 Bacteria 6032
61 Ga0207705_10319499 3300025909 Bacteria 1193
62 Ga0207654_10000673 3300025911 Bacteria 19202
63 Ga0207695_10000497 3300025913 Bacteria 83894
64 Ga0207671_10016475 3300025914 Bacteria 5742
65 Ga0207652_10014535 3300025921 Bacteria 6378
66 Ga0207646_10247955 3300025922 Bacteria 1608
67 Ga0207681_10000208 3300025923 Bacteria 46826
68 Ga0207694_10000571 3300025924 Bacteria 33435
69 Ga0207694_10013024 3300025924 Bacteria 6262
70 Ga0207694_10094950 3300025924 Bacteria 2357
71 Ga0207686_10013885 3300025934 Unclassified 4468
72 Ga0207670_10186847 3300025936 Bacteria 1565
73 Ga0207667_10012104 3300025949 Bacteria 9970
74 Ga0207667_10573477 3300025949 Bacteria 1140
75 Ga0207640_10128345 3300025981 Bacteria 1829
76 Ga0207658_10056614 3300025986 Bacteria 2910
77 Ga0207702_10000003 3300026078 Bacteria 434196
78 Ga0207674_10128158 3300026116 Bacteria 2502
79 Ga0209813_10005765 3300027866 Bacteria 3025
80 Ga0268265_10017668 3300028380 Viruses 4929
81 Ga0265336_10032710 3300028666 Unclassified 1612
82 Ga0265339_10080335 3300031249 Archaea 1724
83 Ga0265327_10004532 3300031251 Bacteria 12243
84 Ga0265313_10001452 3300031595 Bacteria 22114
85 Ga0265313_10052137 3300031595 Unclassified 1954
86 Ga0307510_10040860 3300033180 Bacteria 5082
87 Ga0307510_10130797 3300033180 Bacteria 2184
88 Ga0395899_0000360 3300037312 Bacteria 55326
89 Ga0395899_0033207 3300037312 Bacteria 3876
90 Ga0395899_0315130 3300037312 Bacteria 1055
91 Ga0395900_0001594 3300037418 Bacteria 26769
92 Ga0395900_0013874 3300037418 Bacteria 8221
93 Ga0395898_0000850 3300037466 Bacteria 50106
94 Ga0395898_0004098 3300037466 Bacteria 15989
95 Ga0395905_0005655 3300037471 Bacteria 12714
96 Ga0395905_0303225 3300037471 Bacteria 1485
97 Ga0395901_0000358 3300038443 Bacteria 55326
98 Ga0395901_0531218 3300038443 Bacteria 1194
99 Ga0400483_053073 3300039062 Bacteria 47252
100 Ga0400483_204454 3300039062 Bacteria 47356
101 Ga0436365_0797127 3300039437 Bacteria 2735
102 Ga0436365_1794861 3300039437 Bacteria 40929
103 Ga0436362_0126459 3300039453 Bacteria 236400
104 Ga0436362_1070468 3300039453 Unclassified 3562
105 Ga0451576_0507150 3300045051 Bacteria 1267
106 Ga0495638_0138124 3300046460 Bacteria 1425
107 Ga0495616_0000018 3300046513 Bacteria 167281
108 Ga0495616_0000358 3300046513 Bacteria 35867
109 Ga0495628_0352196 3300046516 Bacteria 1082
110 Ga0495648_0047438 3300046524 Bacteria 2654
111 Ga0495648_0074951 3300046524 Bacteria 1948
112 Ga0495625_0166314 3300046660 Bacteria 1474
113 Ga0495669_0173497 3300046684 Bacteria 1026
114 Ga0495677_0004891 3300047445 Bacteria 5109
115 Ga0495686_0060012 3300047472 Bacteria 2365
116 Ga0496112_0001569 3300048915 Bacteria 17653
117 Ga0496118_0036083 3300048921 Bacteria 4003
118 Ga0496121_0000274 3300048924 Bacteria 107140
119 Ga0496121_0114130 3300048924 Bacteria 2054
120 Ga0501293_001347 3300049516 Bacteria 1843
121 Ga0501032_0293895 3300049569 Bacteria 1051
122 Ga0501033_0111026 3300049570 Bacteria 1995
123 Ga0501034_0066020 3300049571 Bacteria 3632
124 Ga0501034_0163612 3300049571 Bacteria 2194
125 Ga0501047_0233234 3300049581 Bacteria 1693
126 Ga0501070_0010714 3300049586 Bacteria 7749
127 Ga0501070_0128302 3300049586 Bacteria 2096
128 Ga0501280_000395 3300049776 Bacteria 10612
129 Ga0501035_0141361 3300049822 Bacteria 2093
130 Ga0501044_0166305 3300049823 Bacteria 2179
131 nmdc:mga06z11_15842_c1 3300050494 Bacteria 3377
132 nmdc:mga04h51_6223_c1 3300050495 Bacteria 3083
133 nmdc:mga07m45_62258_c1 3300050496 Bacteria 2114
134 nmdc:mga05p37_522788_c1 3300050507 Bacteria 1357
135 nmdc:mga0n895_41299_c1 3300050512 Bacteria 4483
136 nmdc:mga0n895_7696_c1 3300050512 Bacteria 9269
137 nmdc:mga0rr50_155096_c1 3300050513 Bacteria 1854
138 Ga0500581_020247 3300053089 Bacteria 3359
139 Ga0500566_0001014 3300053094 Bacteria 16185
140 Ga0500594_0028750 3300053118 Bacteria 1449
141 Ga0500607_000324 3300053121 Bacteria 45136
142 Ga0500607_120261 3300053121 Bacteria 1272
143 Ga0500642_0000019 3300053130 Bacteria 159944
144 Ga0500568_0010078 3300053139 Unclassified 4451
145 Ga0500577_0000186 3300053142 Bacteria 16209
146 Ga0500588_0000256 3300053146 Bacteria 7678
147 Ga0500590_074862 3300053148 Bacteria 1675
148 Ga0500616_0013877 3300053153 Bacteria 4651
149 Ga0500616_0018147 3300053153 Bacteria 3981
150 Ga0500620_044605 3300053155 Bacteria 1467
151 Ga0500636_0000453 3300053177 Bacteria 22378
152 Ga0500636_0106665 3300053177 Bacteria 1587
153 Ga0530510_0000212 3300061734 Bacteria 35945
154 2513639540 2513237094 Bacteria 8789602
155 2513655008 2513237096 Bacteria 8722461
156 2513915969 2513237145 Bacteria 8979722
157 2528856363 2528768022 Bacteria 10457665
158 2585262444 2582581305 Bacteria 4895574
159 2643772963 2643221550 Bacteria 4619371
160 2644287761 2643221651 Bacteria 4798932
161 2809065742 2808606401 Bacteria 4586670
162 2809081763 2808606404 Bacteria 4652788
163 2809086133 2808606405 Bacteria 4586632
164 2841740499 2841734538 Bacteria 6784580
165 2880521689 2880518877 Bacteria 5012590
166 2885376517 2885374607 Bacteria 8927485
167 2903451713 2903448605 Bacteria 7357801
168 2904702625
169 2919075514 2919073203 Bacteria 6531949
170 2935930690 2935926038 Bacteria 8601059
171 2935939337 2935934488 Bacteria 8602579
172 2935946286 2935942939 Bacteria 8599779
173 2935955875 2935951376 Bacteria 8602333
174 2935972415 2935967501 Bacteria 8603075
175 2968087295 2968083720 Bacteria 7351627
176 8016523810 8016522445 Bacteria 8156687
177 8016537343 8016530956 Bacteria 8155261
178 8016541611 8016539877 Bacteria 8155419
179 8016551655 8016548790 Bacteria 8155074
180 8016560044 8016557553 Bacteria 8154380
181 8016566998 8016566248 Bacteria 8158151
182 8016579719 8016575299 Bacteria 8154085
183 8016597965 8016595262 Bacteria 8149947
184 8016629311 8016622563 Bacteria 7999408
185 8019537027 8019530166 Bacteria 8155624
186 8019548241 8019547302 Bacteria 7996444
187 8019688668 8019687851 Bacteria 8712826
188 8056695155 8056689827 Bacteria 6712655
189 Ga0105240_10091258
190 JGI24740J21852_10049998
191 JGI24739J22299_10011722
192 JGI24737J22298_10006519
193 JGI25406J46586_10000417
194 JGI25406J46586_10001871
195 rootL2_10097056
196 Ga0065707_10006010
197 Ga0065707_10085001
198 Ga0070658_10082321
199 Ga0070658_10249111
200 Ga0070660_100529418
201 Ga0070689_100188503
202 Ga0070689_100327743
203 Ga0070661_100274989
204 Ga0070669_100001576
205 Ga0070667_100033001
206 Ga0070708_100000923
207 Ga0070706_100024054
208 Ga0070698_100519467
209 Ga0070679_100017940
210 Ga0070696_100024872
211 Ga0068855_100193070
212 Ga0068854_100090727
213 Ga0068856_100035287
214 Ga0068852_100150293
215 Ga0068851_10009624
216 Ga0068862_100229398
217 Ga0081455_10003214
218 Ga0081455_10039094
219 Ga0081539_10000059
220 Ga0081539_10000748
221 Ga0081539_10011707
222 Ga0075368_10012721
223 Ga0075367_10009591
224 Ga0075434_100047630
225 Ga0075435_100134509
226 Ga0114129_10668885
227 Ga0105241_10000538
228 Ga0105242_10009331
229 Ga0105237_10008882
230 Ga0105238_10051094
231 Ga0105238_10056569
232 Ga0105238_10076919
233 Ga0105239_10001114
234 Ga0105239_10025796
235 Ga0105239_10649911
236 Ga0157371_10030014
237 Ga0157371_10075861
238 Ga0157369_10012487
239 Ga0157374_10006457
240 Ga0157374_10399533
241 Ga0157380_10101525
242 Ga0182008_10062351
243 Ga0157377_10005455
244 Ga0213873_10000012
245 Ga0213876_10000021
246 Ga0213875_10063281
247 Ga0207647_10002932
248 Ga0207705_10012899
249 Ga0207705_10319499
250 Ga0207654_10000673
251 Ga0207695_10000497
252 Ga0207671_10016475
253 Ga0207652_10014535
254 Ga0207646_10247955
255 Ga0207681_10000208
256 Ga0207694_10000571
257 Ga0207694_10013024
258 Ga0207694_10094950
259 Ga0207686_10013885
260 Ga0207670_10186847
261 Ga0207667_10012104
262 Ga0207667_10573477
263 Ga0207640_10128345
264 Ga0207658_10056614
265 Ga0207702_10000003
266 Ga0207674_10128158
267 Ga0209813_10005765
268 Ga0268265_10017668
269 Ga0265336_10032710
270 Ga0265339_10080335
271 Ga0265327_10004532
272 Ga0265313_10001452
273 Ga0265313_10052137
274 Ga0307510_10040860
275 Ga0307510_10130797
276 Ga0395899_0000360
277 Ga0395899_0033207
278 Ga0395899_0315130
279 Ga0395900_0001594
280 Ga0395900_0013874
281 Ga0395898_0000850
282 Ga0395898_0004098
283 Ga0395905_0005655
284 Ga0395905_0303225
285 Ga0395901_0000358
286 Ga0395901_0531218
287 Ga0400483_053073
288 Ga0400483_204454
289 Ga0436365_0797127
290 Ga0436365_1794861
291 Ga0436362_0126459
292 Ga0436362_1070468
293 Ga0451576_0507150
294 Ga0495638_0138124
295 Ga0495616_0000018
296 Ga0495616_0000358
297 Ga0495628_0352196
298 Ga0495648_0047438
299 Ga0495648_0074951
300 Ga0495625_0166314
301 Ga0495669_0173497
302 Ga0495677_0004891
303 Ga0495686_0060012
304 Ga0496112_0001569
305 Ga0496118_0036083
306 Ga0496121_0000274
307 Ga0496121_0114130
308 Ga0501293_001347
309 Ga0501032_0293895
310 Ga0501033_0111026
311 Ga0501034_0066020
312 Ga0501034_0163612
313 Ga0501047_0233234
314 Ga0501070_0010714
315 Ga0501070_0128302
316 Ga0501280_000395
317 Ga0501035_0141361
318 Ga0501044_0166305
319 nmdc:mga06z11_15842_c1
320 nmdc:mga04h51_6223_c1
321 nmdc:mga07m45_62258_c1
322 nmdc:mga05p37_522788_c1
323 nmdc:mga0n895_41299_c1
324 nmdc:mga0n895_7696_c1
325 nmdc:mga0rr50_155096_c1
326 Ga0500581_020247
327 Ga0500566_0001014
328 Ga0500594_0028750
329 Ga0500607_000324
330 Ga0500607_120261
331 Ga0500642_0000019
332 Ga0500568_0010078
333 Ga0500577_0000186
334 Ga0500588_0000256
335 Ga0500590_074862
336 Ga0500616_0013877
337 Ga0500616_0018147
338 Ga0500620_044605
339 Ga0500636_0000453
340 Ga0500636_0106665
341 Ga0530510_0000212
342 2513639540
343 2513655008
344 2513915969
345 2528856363
346 2585262444
347 2643772963
348 2644287761
349 2809065742
350 2809081763
351 2809086133
352 2841740499
353 2880521689
354 2885376517
355 2903451713
356 2904702625
357 2919075514
358 2935930690
359 2935939337
360 2935946286
361 2935955875
362 2935972415
363 2968087295
364 8016523810
365 8016537343
366 8016541611
367 8016551655
368 8016560044
369 8016566998
370 8016579719
371 8016597965
372 8016629311
373 8019537027
374 8019548241
375 8019688668
376 8056695155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r0q-assembly1.cif.gz_F crystal structure of a serine recombinase- dna regulatory complex 0.9598 21 53
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.8996 23 62
2lvs-assembly1.cif.gz_A nmr solution structure of a crispr repeat binding protein 0.8989 21 53
6pax-assembly1.cif.gz_A crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions 0.8781 12 52
1trr-assembly1.cif.gz_A tandem binding in crystals of a trp repressor/operator half-site complex 0.8618 20 53
ID Description Score Start End Superfamily
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9598 21 53 1.10.10.60
af_H2KY86_676_859_1.10.3380.20 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.9316 26 65 1.10.3380.20
af_P24610_34_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9244 14 52 1.10.10.10
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9194 14 53 1.10.10.10
1zt9A00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9124 20 53 1.10.1270.10
ID Description Score Start End GO Terms
AF-X1VX61-F1-model_v4 DDE domain-containing protein 0.9866 106 177
AF-A0A518BZJ8-F1-model_v4 Transposase 0.9734 15 153
AF-G2JAN9-F1-model_v4 Transposase 0.9723 70 160
AF-A0A2E3H6D1-F1-model_v4 IS1 family transposase 0.9622 40 141
AF-X1VX61-F1-model_v4 DDE domain-containing protein 0.9603 106 177

Map