F289000

General Info

Members Datasets Scaffolds Average Seq Length
188 136 376 180

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100300172|Ga0070679_1003001722
Length 204
Sequence VLTARRLVALDHVAPVCAVLQEYRVAIQPIRLFGDPVLRTPAELVTTFDKELRKLVRDLVDTMQDAPGAGLAAPQIGVGLRVFTYDVDGVVGHLINPVLDLSDEQQDGDEGCLSFPGLAFPCKRAMHAVAKGFNEYGDPVIIEGSELLARCVQHETDHLDGVLFIDRLDPEQRKLAMRAIREADWAGDSVRVKESPHTTYGRAL

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
130 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
131 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
132 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
133 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
134 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
135 2891562705 Microbispora tritici MT50 Isolate Unclassified
136 2902582711 Micromonospora sp. AP08 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.02
Metatranscriptomes 3.72
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 6.91
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100300172 3300005530 Bacteria 1557
2 Ga0070658_10000155 3300005327 Bacteria 60553
3 Ga0070658_10003299 3300005327 Bacteria 13312
4 Ga0070658_10249967 3300005327 Bacteria 1504
5 Ga0070658_10311580 3300005327 Bacteria 1343
6 Ga0070658_11146618 3300005327 Bacteria 676
7 Ga0070680_100087413 3300005336 Bacteria 2578
8 Ga0070680_100314386 3300005336 Bacteria 1329
9 Ga0070660_100305000 3300005339 Bacteria 1306
10 Ga0070661_100784946 3300005344 Bacteria 781
11 Ga0070671_100318546 3300005355 Bacteria 1325
12 Ga0070667_100125971 3300005367 Bacteria 2232
13 Ga0070714_100217591 3300005435 Bacteria 1754
14 Ga0070681_10889769 3300005458 Bacteria 809
15 Ga0070707_100022729 3300005468 Bacteria 5930
16 Ga0070679_100236364 3300005530 Bacteria 1786
17 Ga0070684_100010697 3300005535 Bacteria 7278
18 Ga0070684_100315771 3300005535 Bacteria 1435
19 Ga0068855_100004375 3300005563 Bacteria 17261
20 Ga0068855_100131380 3300005563 Bacteria 2859
21 Ga0068855_100518774 3300005563 Bacteria 1293
22 Ga0068856_100529827 3300005614 Bacteria 1199
23 Ga0068852_100074858 3300005616 Bacteria 2984
24 Ga0068852_100168032 3300005616 Bacteria 2054
25 Ga0070717_10607472 3300006028 Bacteria 992
26 Ga0070712_101192995 3300006175 Bacteria 662
27 Ga0075428_100338166 3300006844 Bacteria 1617
28 Ga0075430_100418473 3300006846 Bacteria 1106
29 Ga0099794_10149997 3300007265 Bacteria 1183
30 Ga0105240_10027997 3300009093 Bacteria 7369
31 Ga0105245_10017991 3300009098 Bacteria 6172
32 Ga0114129_10202096 3300009147 Bacteria 2691
33 Ga0114129_10229117 3300009147 Bacteria 2503
34 Ga0114129_10265376 3300009147 Bacteria 2299
35 Ga0105243_10762729 3300009148 Bacteria 950
36 Ga0105242_10057296 3300009176 Bacteria 3190
37 Ga0105242_10183680 3300009176 Bacteria 1847
38 Ga0105248_10420403 3300009177 Bacteria 1505
39 Ga0157370_10017414 3300013104 Bacteria 7250
40 Ga0157370_10500724 3300013104 Bacteria 1115
41 Ga0157370_10963472 3300013104 Bacteria 773
42 Ga0157369_10002545 3300013105 Bacteria 21809
43 Ga0157378_10603600 3300013297 Bacteria 1109
44 Ga0163162_10525024 3300013306 Bacteria 1313
45 Ga0163163_10064153 3300014325 Bacteria 3645
46 Ga0163161_10052759 3300017792 Bacteria 2947
47 Ga0197907_10455455 3300020069 Bacteria 1247
48 Ga0197907_10821412 3300020069 Bacteria 717
49 Ga0206351_10141837 3300020077 Bacteria 568
50 Ga0206354_10407351 3300020081 Bacteria 1900
51 Ga0206353_10796702 3300020082 Bacteria 4537
52 Ga0224712_10012768 3300022467 Bacteria 2654
53 Ga0224712_10328920 3300022467 Bacteria 719
54 Ga0207705_10004990 3300025909 Bacteria 9954
55 Ga0207705_10095745 3300025909 Bacteria 2179
56 Ga0207705_10133186 3300025909 Bacteria 1851
57 Ga0207705_10222336 3300025909 Bacteria 1435
58 Ga0207705_10223969 3300025909 Bacteria 1429
59 Ga0207707_10433313 3300025912 Bacteria 1126
60 Ga0207707_11068025 3300025912 Bacteria 659
61 Ga0207695_10051161 3300025913 Bacteria 4340
62 Ga0207657_10082552 3300025919 Bacteria 2697
63 Ga0207657_10098582 3300025919 Bacteria 2428
64 Ga0207652_10054737 3300025921 Bacteria 3430
65 Ga0207652_10304645 3300025921 Bacteria 1438
66 Ga0207646_10046945 3300025922 Bacteria 3875
67 Ga0207690_10110354 3300025932 Bacteria 1980
68 Ga0207709_10867353 3300025935 Bacteria 732
69 Ga0207661_10112574 3300025944 Bacteria 2304
70 Ga0207661_10325466 3300025944 Bacteria 1383
71 Ga0207679_10388212 3300025945 Bacteria 1225
72 Ga0207667_10250328 3300025949 Bacteria 1812
73 Ga0207702_10693275 3300026078 Bacteria 1003
74 Ga0207676_10613754 3300026095 Bacteria 1046
75 Ga0207683_10375856 3300026121 Bacteria 1306
76 Ga0207698_10072382 3300026142 Bacteria 2740
77 Ga0265325_10199725 3300031241 Bacteria 923
78 Ga0265340_10005442 3300031247 Bacteria 7072
79 Ga0265331_10137376 3300031250 Bacteria 1113
80 Ga0265316_10081161 3300031344 Bacteria 2487
81 Ga0265313_10074290 3300031595 Bacteria 1559
82 Ga0265313_10284859 3300031595 Bacteria 667
83 Ga0307508_10079751 3300031616 Bacteria 2855
84 Ga0265342_10039009 3300031712 Bacteria 2889
85 Ga0307516_10075911 3300031730 Bacteria 3214
86 Ga0307405_10008201 3300031731 Bacteria 5281
87 Ga0307405_10517803 3300031731 Bacteria 959
88 Ga0316577_10415715 3300031733 Bacteria 764
89 Ga0307413_10167328 3300031824 Bacteria 1552
90 Ga0307413_10311087 3300031824 Bacteria 1199
91 Ga0307406_10939776 3300031901 Bacteria 738
92 Ga0307409_100801890 3300031995 Bacteria 949
93 Ga0307409_100930797 3300031995 Bacteria 884
94 Ga0307415_100138267 3300032126 Bacteria 1856
95 Ga0307415_100517582 3300032126 Bacteria 1046
96 Ga0316583_10144131 3300032133 Bacteria 830
97 Ga0373946_0062109 3300035171 Bacteria 1593
98 Ga0373927_0351475 3300035695 Bacteria 971
99 Ga0373947_0015037 3300035725 Bacteria 4443
100 Ga0373937_0510161 3300036401 Bacteria 1142
101 Ga0373925_0001213 3300037068 Bacteria 22751
102 Ga0395899_0173359 3300037312 Bacteria 1518
103 Ga0395900_0089872 3300037418 Bacteria 3157
104 Ga0395898_0526568 3300037466 Bacteria 1123
105 Ga0395898_0646397 3300037466 Bacteria 1000
106 Ga0395901_0048869 3300038443 Bacteria 4394
107 Ga0395901_0309901 3300038443 Bacteria 1635
108 Ga0466972_0013115 3300044658 Bacteria 4164
109 Ga0466966_0278271 3300044684 Bacteria 1007
110 Ga0466961_0002410 3300044693 Bacteria 11621
111 Ga0466961_0035287 3300044693 Bacteria 3212
112 Ga0466961_0038720 3300044693 Bacteria 3059
113 Ga0466961_0059663 3300044693 Bacteria 2426
114 Ga0466961_0096866 3300044693 Bacteria 1860
115 Ga0466961_0109098 3300044693 Bacteria 1742
116 Ga0466963_0005697 3300044694 Bacteria 7320
117 Ga0466963_0125585 3300044694 Bacteria 1768
118 Ga0466971_0084788 3300044719 Bacteria 1447
119 Ga0466957_0051732 3300044842 Bacteria 2500
120 Ga0466960_0407644 3300044901 Bacteria 784
121 Ga0466959_0000786 3300045049 Bacteria 18627
122 Ga0466959_0407287 3300045049 Bacteria 924
123 Ga0466959_0431136 3300045049 Bacteria 894
124 Ga0466958_0146259 3300045836 Bacteria 1489
125 Ga0466958_0283267 3300045836 Bacteria 1062
126 Ga0466967_0022697 3300045976 Bacteria 5127
127 Ga0466967_0075686 3300045976 Bacteria 3026
128 Ga0466967_0100084 3300045976 Bacteria 2648
129 Ga0466967_0108624 3300045976 Bacteria 2546
130 Ga0466967_0140864 3300045976 Bacteria 2246
131 Ga0495603_0214270 3300046455 Bacteria 1112
132 Ga0495629_0417184 3300046459 Bacteria 911
133 Ga0495651_0082700 3300046462 Bacteria 2422
134 Ga0495664_0069459 3300046477 Bacteria 2103
135 Ga0495628_0058433 3300046516 Bacteria 3030
136 Ga0495652_0002640 3300046529 Bacteria 18286
137 Ga0495652_0108436 3300046529 Bacteria 2238
138 Ga0495665_0300468 3300046531 Bacteria 822
139 Ga0495640_0039340 3300046533 Bacteria 3319
140 Ga0495586_0072448 3300046535 Bacteria 1884
141 Ga0495598_0204431 3300046537 Bacteria 715
142 Ga0495645_0029854 3300046543 Bacteria 3969
143 Ga0495645_0054011 3300046543 Bacteria 2919
144 Ga0495645_0155707 3300046543 Bacteria 1583
145 Ga0495635_0010705 3300046663 Bacteria 6423
146 Ga0495635_0329297 3300046663 Bacteria 1021
147 Ga0495623_0026471 3300046679 Bacteria 3733
148 Ga0495646_0011399 3300046680 Bacteria 5645
149 Ga0495676_0206894 3300047321 Bacteria 1360
150 Ga0496101_0131043 3300048904 Bacteria 1904
151 Ga0496102_0226443 3300048905 Bacteria 1763
152 Ga0496102_0283795 3300048905 Bacteria 1561
153 Ga0496104_0086163 3300048907 Bacteria 2999
154 Ga0496106_0284010 3300048909 Bacteria 1326
155 Ga0496108_0190497 3300048911 Bacteria 1777
156 Ga0496109_0089791 3300048912 Bacteria 2841
157 Ga0496110_0059994 3300048913 Bacteria 3354
158 Ga0496111_0193621 3300048914 Bacteria 1511
159 Ga0496112_0021103 3300048915 Bacteria 6188
160 Ga0496113_0173064 3300048916 Bacteria 1710
161 Ga0496114_0041313 3300048917 Bacteria 3821
162 Ga0496115_0562901 3300048918 Bacteria 910
163 Ga0496119_0001269 3300048922 Bacteria 31365
164 Ga0496120_0015501 3300048923 Bacteria 5022
165 Ga0501047_0102112 3300049581 Bacteria 2747
166 Ga0501069_0146970 3300049585 Bacteria 1353
167 Ga0501070_0032113 3300049586 Bacteria 4395
168 Ga0501072_0911057 3300049588 Bacteria 687
169 Ga0501073_0141711 3300049589 Bacteria 1666
170 Ga0501074_0231667 3300049590 Bacteria 1315
171 Ga0501076_0513590 3300049592 Bacteria 988
172 Ga0501080_0565732 3300049742 Bacteria 1012
173 Ga0501044_0070363 3300049823 Bacteria 3559
174 nmdc:mga05p37_250792_c1 3300050507 Bacteria 2123
175 Ga0495601_0078566 3300053077 Bacteria 2114
176 Ga0495601_0324255 3300053077 Bacteria 1003
177 Ga0495612_0005502 3300053078 Bacteria 5237
178 Ga0495612_0154101 3300053078 Bacteria 1001
179 Ga0500660_073659 3300053100 Bacteria 1591
180 Ga0501084_0964138 3300054114 Bacteria 717
181 2676487928 2675903060 Bacteria 10051191
182 2731906981 2731639228 Bacteria 4187555
183 2819739043 2818991472 Bacteria 10089953
184 2856742828 2856741275 Bacteria 8096094
185 2873320831 2873314349 Bacteria 8512634
186 2891403117 2891395885 Bacteria 9251614
187 2891564658 2891562705 Bacteria 8039471
188 2902584927 2902582711 Bacteria 6187705
189 Ga0070679_100300172
190 Ga0070658_10000155
191 Ga0070658_10003299
192 Ga0070658_10249967
193 Ga0070658_10311580
194 Ga0070658_11146618
195 Ga0070680_100087413
196 Ga0070680_100314386
197 Ga0070660_100305000
198 Ga0070661_100784946
199 Ga0070671_100318546
200 Ga0070667_100125971
201 Ga0070714_100217591
202 Ga0070681_10889769
203 Ga0070707_100022729
204 Ga0070679_100236364
205 Ga0070684_100010697
206 Ga0070684_100315771
207 Ga0068855_100004375
208 Ga0068855_100131380
209 Ga0068855_100518774
210 Ga0068856_100529827
211 Ga0068852_100074858
212 Ga0068852_100168032
213 Ga0070717_10607472
214 Ga0070712_101192995
215 Ga0075428_100338166
216 Ga0075430_100418473
217 Ga0099794_10149997
218 Ga0105240_10027997
219 Ga0105245_10017991
220 Ga0114129_10202096
221 Ga0114129_10229117
222 Ga0114129_10265376
223 Ga0105243_10762729
224 Ga0105242_10057296
225 Ga0105242_10183680
226 Ga0105248_10420403
227 Ga0157370_10017414
228 Ga0157370_10500724
229 Ga0157370_10963472
230 Ga0157369_10002545
231 Ga0157378_10603600
232 Ga0163162_10525024
233 Ga0163163_10064153
234 Ga0163161_10052759
235 Ga0197907_10455455
236 Ga0197907_10821412
237 Ga0206351_10141837
238 Ga0206354_10407351
239 Ga0206353_10796702
240 Ga0224712_10012768
241 Ga0224712_10328920
242 Ga0207705_10004990
243 Ga0207705_10095745
244 Ga0207705_10133186
245 Ga0207705_10222336
246 Ga0207705_10223969
247 Ga0207707_10433313
248 Ga0207707_11068025
249 Ga0207695_10051161
250 Ga0207657_10082552
251 Ga0207657_10098582
252 Ga0207652_10054737
253 Ga0207652_10304645
254 Ga0207646_10046945
255 Ga0207690_10110354
256 Ga0207709_10867353
257 Ga0207661_10112574
258 Ga0207661_10325466
259 Ga0207679_10388212
260 Ga0207667_10250328
261 Ga0207702_10693275
262 Ga0207676_10613754
263 Ga0207683_10375856
264 Ga0207698_10072382
265 Ga0265325_10199725
266 Ga0265340_10005442
267 Ga0265331_10137376
268 Ga0265316_10081161
269 Ga0265313_10074290
270 Ga0265313_10284859
271 Ga0307508_10079751
272 Ga0265342_10039009
273 Ga0307516_10075911
274 Ga0307405_10008201
275 Ga0307405_10517803
276 Ga0316577_10415715
277 Ga0307413_10167328
278 Ga0307413_10311087
279 Ga0307406_10939776
280 Ga0307409_100801890
281 Ga0307409_100930797
282 Ga0307415_100138267
283 Ga0307415_100517582
284 Ga0316583_10144131
285 Ga0373946_0062109
286 Ga0373927_0351475
287 Ga0373947_0015037
288 Ga0373937_0510161
289 Ga0373925_0001213
290 Ga0395899_0173359
291 Ga0395900_0089872
292 Ga0395898_0526568
293 Ga0395898_0646397
294 Ga0395901_0048869
295 Ga0395901_0309901
296 Ga0466972_0013115
297 Ga0466966_0278271
298 Ga0466961_0002410
299 Ga0466961_0035287
300 Ga0466961_0038720
301 Ga0466961_0059663
302 Ga0466961_0096866
303 Ga0466961_0109098
304 Ga0466963_0005697
305 Ga0466963_0125585
306 Ga0466971_0084788
307 Ga0466957_0051732
308 Ga0466960_0407644
309 Ga0466959_0000786
310 Ga0466959_0407287
311 Ga0466959_0431136
312 Ga0466958_0146259
313 Ga0466958_0283267
314 Ga0466967_0022697
315 Ga0466967_0075686
316 Ga0466967_0100084
317 Ga0466967_0108624
318 Ga0466967_0140864
319 Ga0495603_0214270
320 Ga0495629_0417184
321 Ga0495651_0082700
322 Ga0495664_0069459
323 Ga0495628_0058433
324 Ga0495652_0002640
325 Ga0495652_0108436
326 Ga0495665_0300468
327 Ga0495640_0039340
328 Ga0495586_0072448
329 Ga0495598_0204431
330 Ga0495645_0029854
331 Ga0495645_0054011
332 Ga0495645_0155707
333 Ga0495635_0010705
334 Ga0495635_0329297
335 Ga0495623_0026471
336 Ga0495646_0011399
337 Ga0495676_0206894
338 Ga0496101_0131043
339 Ga0496102_0226443
340 Ga0496102_0283795
341 Ga0496104_0086163
342 Ga0496106_0284010
343 Ga0496108_0190497
344 Ga0496109_0089791
345 Ga0496110_0059994
346 Ga0496111_0193621
347 Ga0496112_0021103
348 Ga0496113_0173064
349 Ga0496114_0041313
350 Ga0496115_0562901
351 Ga0496119_0001269
352 Ga0496120_0015501
353 Ga0501047_0102112
354 Ga0501069_0146970
355 Ga0501070_0032113
356 Ga0501072_0911057
357 Ga0501073_0141711
358 Ga0501074_0231667
359 Ga0501076_0513590
360 Ga0501080_0565732
361 Ga0501044_0070363
362 nmdc:mga05p37_250792_c1
363 Ga0495601_0078566
364 Ga0495601_0324255
365 Ga0495612_0005502
366 Ga0495612_0154101
367 Ga0500660_073659
368 Ga0501084_0964138
369 2676487928
370 2731906981
371 2819739043
372 2856742828
373 2873320831
374 2891403117
375 2891564658
376 2902584927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

27

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9611 11 151
6jf4-assembly1.cif.gz_A k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9561 11 150
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9537 11 152
6jf7-assembly1.cif.gz_B k3u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9464 11 151
3cpm-assembly1.cif.gz_A plant peptide deformylase pdf1b crystal structure 0.9439 12 161
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9611 11 151 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9532 11 152 3.90.45.10
3g5pA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9423 12 155 3.90.45.10
af_A0A0R0ELH1_60_189_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9409 11 109 3.90.45.10
af_K7VJY5_57_249_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9395 11 161 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A7R8PAA5-F1-model_v4 deleted 0.9749 12 168
AF-A0A1H3P2V1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9733 11 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A838JP98-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9714 12 165 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A4Q3ABE0-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9712 12 137 GO:0042586
GO:0043686
AF-A0A7V9H4M5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.971 12 165 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map