F288921

General Info

Members Datasets Scaffolds Average Seq Length
188 135 187 145

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100022635|Ga0070713_1000226353
Length 158
Sequence VTAPVPPSSAGGSGGAGRLPLYRTFAFQHPDIAGPAGPGLQVRGRGDLAMVDVGESVRQGIFLLLTTIPGERVMRPDYGCDLHQLVFSPNDETTAGLAIHYVRRALDQFEPRAEVVRVDAGANPDDPGRLDVTLDYRVRATQQDGQLTVSISLQGEPT

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.06
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.13
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10033938 3300003203 Unclassified 1878
2 Ga0070670_100005583 3300005331 Bacteria 10610
3 Ga0070670_100461405 3300005331 Bacteria 1127
4 Ga0070666_10013800 3300005335 Bacteria 5133
5 Ga0070682_100004489 3300005337 Bacteria 7751
6 Ga0068868_100058676 3300005338 Unclassified 3042
7 Ga0070687_100014900 3300005343 Bacteria 3503
8 Ga0070687_100517476 3300005343 Bacteria 806
9 Ga0070661_100007733 3300005344 Bacteria 7423
10 Ga0070669_100008517 3300005353 Bacteria 7321
11 Ga0070669_100993335 3300005353 Bacteria 720
12 Ga0070675_100292829 3300005354 Unclassified 1433
13 Ga0070675_101583812 3300005354 Unclassified 604
14 Ga0070671_100006572 3300005355 Bacteria 9295
15 Ga0070673_100091628 3300005364 Unclassified 2485
16 Ga0070688_100099304 3300005365 Bacteria 1916
17 Ga0070667_100008377 3300005367 Bacteria 8572
18 Ga0070713_100022635 3300005436 Bacteria 4859
19 Ga0070701_10406178 3300005438 Unclassified 864
20 Ga0070694_100175557 3300005444 Bacteria 1581
21 Ga0070662_100605848 3300005457 Bacteria 922
22 Ga0070685_10657025 3300005466 Bacteria 760
23 Ga0070686_100002654 3300005544 Bacteria 9858
24 Ga0070686_100003136 3300005544 Bacteria 9052
25 Ga0070704_100376854 3300005549 Bacteria 1204
26 Ga0070664_100002667 3300005564 Bacteria 14398
27 Ga0068857_100435602 3300005577 Bacteria 1224
28 Ga0070702_100527871 3300005615 Unclassified 872
29 Ga0068864_100006169 3300005618 Bacteria 9828
30 Ga0068861_100007250 3300005719 Bacteria 7599
31 Ga0068861_101173614 3300005719 Bacteria 741
32 Ga0068851_10090832 3300005834 Bacteria 1607
33 Ga0068863_100001473 3300005841 Bacteria 23304
34 Ga0068863_100049208 3300005841 Unclassified 3996
35 Ga0068863_100090642 3300005841 Bacteria 2899
36 Ga0068858_100378455 3300005842 Bacteria 1358
37 Ga0068860_100010422 3300005843 Bacteria 9192
38 Ga0068862_101443683 3300005844 Bacteria 692
39 Ga0081455_10587730 3300005937 Bacteria 728
40 Ga0081539_10002031 3300005985 Bacteria 30485
41 Ga0081539_10028191 3300005985 Viruses 3536
42 Ga0070717_10001606 3300006028 Bacteria 15636
43 Ga0070717_10179204 3300006028 Bacteria 1846
44 Ga0068871_100402448 3300006358 Unclassified 1219
45 Ga0068871_100584583 3300006358 Unclassified 1014
46 Ga0075428_100000238 3300006844 Bacteria 53672
47 Ga0075428_100715630 3300006844 Bacteria 1066
48 Ga0075428_102149190 3300006844 Unclassified 577
49 Ga0075430_100039038 3300006846 Bacteria 4021
50 Ga0075430_100089717 3300006846 Bacteria 2572
51 Ga0075430_100274944 3300006846 Unclassified 1394
52 Ga0075430_101178811 3300006846 Unclassified 631
53 Ga0075431_100001500 3300006847 Bacteria 21616
54 Ga0075431_100018840 3300006847 Bacteria 7031
55 Ga0075431_100082493 3300006847 Bacteria 3319
56 Ga0075433_10058120 3300006852 Unclassified 3382
57 Ga0075433_10227623 3300006852 Bacteria 1656
58 Ga0075429_100452061 3300006880 Bacteria 1126
59 Ga0097620_100359805 3300006931 Unclassified 1550
60 Ga0099794_10040035 3300007265 Bacteria 2227
61 Ga0099794_10146350 3300007265 Bacteria 1198
62 Ga0105240_10283058 3300009093 Unclassified 1904
63 Ga0105240_10314409 3300009093 Bacteria 1787
64 Ga0111539_10002964 3300009094 Bacteria 22508
65 Ga0111539_10010161 3300009094 Bacteria 11863
66 Ga0114129_10021850 3300009147 Bacteria 9082
67 Ga0114129_10487470 3300009147 Unclassified 1612
68 Ga0114129_11139977 3300009147 Viruses 974
69 Ga0105243_10023036 3300009148 Bacteria 4737
70 Ga0105248_10026654 3300009177 Bacteria 6426
71 Ga0105237_10029503 3300009545 Bacteria 5575
72 Ga0157374_10441468 3300013296 Unclassified 1302
73 Ga0157378_10321831 3300013297 Unclassified 1502
74 Ga0157378_10737206 3300013297 Bacteria 1007
75 Ga0163162_10005391 3300013306 Bacteria 12354
76 Ga0157372_10480743 3300013307 Unclassified 1448
77 Ga0157375_10000556 3300013308 Bacteria 33512
78 Ga0157375_10331017 3300013308 Bacteria 1688
79 Ga0163163_10384856 3300014325 Unclassified 1460
80 Ga0163163_10711054 3300014325 Unclassified 1068
81 Ga0157380_10585354 3300014326 Bacteria 1101
82 Ga0182008_10334748 3300014497 Bacteria 799
83 Ga0157379_10201594 3300014968 Bacteria 1799
84 Ga0157376_10021083 3300014969 Bacteria 5056
85 Ga0213876_10070924 3300021384 Bacteria 1840
86 Ga0207680_10016142 3300025903 Unclassified 3913
87 Ga0207695_10340853 3300025913 Bacteria 1386
88 Ga0207662_10081709 3300025918 Unclassified 1973
89 Ga0207649_10061793 3300025920 Bacteria 2359
90 Ga0207681_10001943 3300025923 Bacteria 13256
91 Ga0207650_10001163 3300025925 Bacteria 19328
92 Ga0207650_10475397 3300025925 Unclassified 1042
93 Ga0207650_10730752 3300025925 Unclassified 837
94 Ga0207659_10182994 3300025926 Bacteria 1662
95 Ga0207659_10700658 3300025926 Bacteria 867
96 Ga0207644_10984816 3300025931 Unclassified 707
97 Ga0207706_10572643 3300025933 Unclassified 971
98 Ga0207670_10136301 3300025936 Bacteria 1805
99 Ga0207711_10025964 3300025941 Unclassified 4913
100 Ga0207679_10008789 3300025945 Bacteria 6443
101 Ga0207651_10087168 3300025960 Unclassified 2271
102 Ga0207712_11018038 3300025961 Bacteria 735
103 Ga0207658_10033345 3300025986 Unclassified 3673
104 Ga0207677_10086675 3300026023 Bacteria 2264
105 Ga0207641_10042993 3300026088 Unclassified 3792
106 Ga0207641_10198328 3300026088 Bacteria 1849
107 Ga0207676_10029473 3300026095 Unclassified 4110
108 Ga0207675_100016326 3300026118 Bacteria 6931
109 Ga0268265_10687629 3300028380 Bacteria 987
110 Ga0268264_10004139 3300028381 Bacteria 12410
111 Ga0316182_1236488 3300030745 Bacteria 13687
112 Ga0265332_10357046 3300031238 Bacteria 603
113 Ga0265316_10680648 3300031344 Bacteria 726
114 Ga0307408_101583825 3300031548 Bacteria 622
115 Ga0316579_10091848 3300031691 Bacteria 1450
116 Ga0265314_10005464 3300031711 Bacteria 11465
117 Ga0316576_10081704 3300031727 Bacteria 2398
118 Ga0316578_10002789 3300031728 Bacteria 7789
119 Ga0316578_10278038 3300031728 Bacteria 1003
120 Ga0316577_10040494 3300031733 Unclassified 2606
121 Ga0316577_10187877 3300031733 Bacteria 1167
122 Ga0307415_100691874 3300032126 Bacteria 919
123 Ga0316583_10031169 3300032133 Bacteria 1899
124 Ga0316583_10062432 3300032133 Unclassified 1305
125 Ga0316585_10026626 3300032137 Unclassified 1800
126 Ga0316596_1043573 3300033541 Bacteria 1182
127 Ga0316574_0205478 3300035398 Bacteria 1264
128 Ga0316582_0041303 3300036647 Bacteria 2882
129 Ga0316582_0115094 3300036647 Unclassified 1794
130 Ga0316582_0417390 3300036647 Unclassified 924
131 Ga0316584_0043763 3300036712 Bacteria 3339
132 Ga0395900_0274734 3300037418 Unclassified 1679
133 Ga0316581_0094466 3300037588 Unclassified 920
134 Ga0436365_0953565 3300039437 Bacteria 948
135 Ga0436365_1904600 3300039437 Bacteria 1217
136 Ga0436365_1927831 3300039437 Bacteria 7308
137 Ga0436360_1361747 3300039438 Unclassified 1465
138 Ga0451839_1346987 3300041496 Unclassified 521
139 Ga0466972_0265545 3300044658 Bacteria 802
140 Ga0453684_0007692 3300044712 Bacteria 19710
141 Ga0453684_0060420 3300044712 Bacteria 4874
142 Ga0453684_0356102 3300044712 Unclassified 1649
143 Ga0453684_0561343 3300044712 Unclassified 1256
144 Ga0453684_0735370 3300044712 Bacteria 1069
145 Ga0453684_1451579 3300044712 Unclassified 709
146 Ga0466960_0363613 3300044901 Bacteria 827
147 Ga0495610_0160497 3300046512 Unclassified 951
148 Ga0495620_0021280 3300046515 Bacteria 3151
149 Ga0495620_0160195 3300046515 Bacteria 874
150 Ga0495630_0000766 3300046517 Bacteria 22532
151 Ga0495663_0000717 3300046525 Bacteria 11398
152 Ga0495640_0312449 3300046533 Bacteria 974
153 Ga0495586_0000011 3300046535 Bacteria 139442
154 Ga0495598_0000191 3300046537 Bacteria 10807
155 Ga0495621_0000737 3300046539 Bacteria 8296
156 Ga0495668_0045442 3300046616 Bacteria 2442
157 Ga0495634_0229627 3300046642 Bacteria 1142
158 Ga0495588_0092126 3300046674 Bacteria 1588
159 Ga0495636_0082319 3300047318 Bacteria 1387
160 Ga0495674_0043161 3300047319 Unclassified 4015
161 Ga0495676_0159420 3300047321 Bacteria 1598
162 Ga0495615_0094429 3300048090 Bacteria 837
163 Ga0496108_1459392 3300048911 Unclassified 570
164 Ga0496109_0000049 3300048912 Bacteria 127530
165 Ga0496109_0286681 3300048912 Bacteria 1552
166 Ga0496115_0578789 3300048918 Bacteria 895
167 Ga0501038_0622544 3300049574 Unclassified 815
168 Ga0501048_0595023 3300049582 Unclassified 794
169 Ga0501081_0057720 3300049743 Bacteria 2685
170 Ga0501035_0000974 3300049822 Bacteria 30264
171 nmdc:mga05p37_14882_c1 3300050507 Bacteria 9343
172 nmdc:mga05p37_417958_c1 3300050507 Unclassified 1561
173 nmdc:mga05p37_748123_c1 3300050507 Viruses 1078
174 nmdc:mga09592_342433_c1 3300050508 Unclassified 1294
175 nmdc:mga0qj67_244349_c1 3300050509 Bacteria 1456
176 nmdc:mga0qj67_33283_c1 3300050509 Bacteria 4021
177 nmdc:mga0qj67_819767_c1 3300050509 Unclassified 736
178 nmdc:mga06r32_4335_c1 3300050510 Bacteria 12704
179 nmdc:mga06r32_613605_c1 3300050510 Bacteria 1058
180 nmdc:mga06r32_7368_c1 3300050510 Bacteria 9900
181 nmdc:mga08y16_1131148_c1 3300050511 Bacteria 757
182 nmdc:mga08y16_192701_c1 3300050511 Bacteria 2114
183 nmdc:mga0a205_405257_c1 3300050515 Bacteria 1227
184 nmdc:mga0a205_74926_c1 3300050515 Unclassified 3270
185 Ga0501084_0208526 3300054114 Bacteria 1649
186 Ga0587109_137927 3300059624 Unclassified 593
187 Ga0530510_0066960 3300061734 Bacteria 2605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100517476 Ga0070687_1005174761 116
2 3300005719 Ga0068861_101173614 Ga0068861_1011736142 136
3 3300046515 Ga0495620_0021280 Ga0495620_0021280_837_1250 137
4 3300006847 Ga0075431_100018840 Ga0075431_1000188408 139
5 3300050510 nmdc:mga06r32_4335_c1 nmdc:mga06r32_4335_c1_6464_6883 139
6 3300007265 Ga0099794_10146350 Ga0099794_101463503 140
7 3300039438 Ga0436360_1361747 Ga0436360_1361747_99_533 140
8 iso_pu_bacteria 2643221546 2643752386 140
9 3300005331 Ga0070670_100005583 Ga0070670_1000055832 141
10 3300005335 Ga0070666_10013800 Ga0070666_100138002 141
11 3300005338 Ga0068868_100058676 Ga0068868_1000586763 141
12 3300005343 Ga0070687_100014900 Ga0070687_1000149004 141
13 3300005344 Ga0070661_100007733 Ga0070661_1000077334 141
14 3300005354 Ga0070675_100292829 Ga0070675_1002928292 141
15 3300005355 Ga0070671_100006572 Ga0070671_1000065721 141
16 3300005364 Ga0070673_100091628 Ga0070673_1000916281 141
17 3300005365 Ga0070688_100099304 Ga0070688_1000993042 141
18 3300005367 Ga0070667_100008377 Ga0070667_1000083772 141
19 3300005544 Ga0070686_100003136 Ga0070686_10000313611 141
20 3300005564 Ga0070664_100002667 Ga0070664_10000266716 141
21 3300005618 Ga0068864_100006169 Ga0068864_1000061697 141
22 3300005719 Ga0068861_100007250 Ga0068861_1000072503 141
23 3300005834 Ga0068851_10090832 Ga0068851_100908322 141
24 3300005841 Ga0068863_100001473 Ga0068863_1000014738 141
25 3300005843 Ga0068860_100010422 Ga0068860_1000104224 141
26 3300005985 Ga0081539_10028191 Ga0081539_100281914 141
27 3300006358 Ga0068871_100584583 Ga0068871_1005845832 141
28 3300006844 Ga0075428_100000238 Ga0075428_10000023862 141
29 3300006844 Ga0075428_100715630 Ga0075428_1007156302 141
30 3300006846 Ga0075430_100039038 Ga0075430_1000390382 141
31 3300006846 Ga0075430_100089717 Ga0075430_1000897172 141
32 3300006847 Ga0075431_100082493 Ga0075431_1000824932 141
33 3300009093 Ga0105240_10283058 Ga0105240_102830583 141
34 3300009177 Ga0105248_10026654 Ga0105248_100266542 141
35 3300009545 Ga0105237_10029503 Ga0105237_100295035 141
36 3300013296 Ga0157374_10441468 Ga0157374_104414682 141
37 3300013306 Ga0163162_10005391 Ga0163162_100053912 141
38 3300013307 Ga0157372_10480743 Ga0157372_104807433 141
39 3300013308 Ga0157375_10000556 Ga0157375_100005562 141
40 3300014325 Ga0163163_10384856 Ga0163163_103848563 141
41 3300014968 Ga0157379_10201594 Ga0157379_102015943 141
42 3300025903 Ga0207680_10016142 Ga0207680_100161424 141
43 3300025918 Ga0207662_10081709 Ga0207662_100817093 141
44 3300025920 Ga0207649_10061793 Ga0207649_100617933 141
45 3300025925 Ga0207650_10730752 Ga0207650_107307521 141
46 3300025926 Ga0207659_10182994 Ga0207659_101829942 141
47 3300025931 Ga0207644_10984816 Ga0207644_109848161 141
48 3300025941 Ga0207711_10025964 Ga0207711_100259641 141
49 3300025945 Ga0207679_10008789 Ga0207679_100087892 141
50 3300025960 Ga0207651_10087168 Ga0207651_100871681 141
51 3300025961 Ga0207712_11018038 Ga0207712_110180382 141
52 3300025986 Ga0207658_10033345 Ga0207658_100333455 141
53 3300026023 Ga0207677_10086675 Ga0207677_100866753 141
54 3300026095 Ga0207676_10029473 Ga0207676_100294732 141
55 3300026118 Ga0207675_100016326 Ga0207675_1000163263 141
56 3300028380 Ga0268265_10687629 Ga0268265_106876293 141
57 3300028381 Ga0268264_10004139 Ga0268264_100041398 141
58 3300031691 Ga0316579_10091848 Ga0316579_100918482 141
59 3300031727 Ga0316576_10081704 Ga0316576_100817042 141
60 3300031728 Ga0316578_10002789 Ga0316578_100027895 141
61 3300031728 Ga0316578_10278038 Ga0316578_102780382 141
62 3300031733 Ga0316577_10040494 Ga0316577_100404942 141
63 3300031733 Ga0316577_10187877 Ga0316577_101878772 141
64 3300032133 Ga0316583_10031169 Ga0316583_100311692 141
65 3300032137 Ga0316585_10026626 Ga0316585_100266261 141
66 3300033541 Ga0316596_1043573 Ga0316596_10435732 141
67 3300035398 Ga0316574_0205478 Ga0316574_0205478_581_1006 141
68 3300036647 Ga0316582_0417390 Ga0316582_0417390_361_786 141
69 3300036712 Ga0316584_0043763 Ga0316584_0043763_2372_2797 141
70 3300037588 Ga0316581_0094466 Ga0316581_0094466_216_641 141
71 3300044901 Ga0466960_0363613 Ga0466960_0363613_106_531 141
72 3300046515 Ga0495620_0160195 Ga0495620_0160195_248_706 141
73 3300046517 Ga0495630_0000766 Ga0495630_0000766_8895_9323 141
74 3300046525 Ga0495663_0000717 Ga0495663_0000717_4166_4624 141
75 3300046533 Ga0495640_0312449 Ga0495640_0312449_105_533 141
76 3300046535 Ga0495586_0000011 Ga0495586_0000011_120224_120652 141
77 3300046537 Ga0495598_0000191 Ga0495598_0000191_7483_7986 141
78 3300046539 Ga0495621_0000737 Ga0495621_0000737_7659_8117 141
79 3300046642 Ga0495634_0229627 Ga0495634_0229627_355_783 141
80 3300047319 Ga0495674_0043161 Ga0495674_0043161_3450_3878 141
81 3300047321 Ga0495676_0159420 Ga0495676_0159420_1074_1502 141
82 3300048918 Ga0496115_0578789 Ga0496115_0578789_309_737 141
83 3300050509 nmdc:mga0qj67_244349_c1 nmdc:mga0qj67_244349_c1_306_740 141
84 3300050509 nmdc:mga0qj67_33283_c1 nmdc:mga0qj67_33283_c1_346_786 141
85 3300050510 nmdc:mga06r32_613605_c1 nmdc:mga06r32_613605_c1_405_839 141
86 3300005436 Ga0070713_100022635 Ga0070713_1000226353 142
87 3300006028 Ga0070717_10001606 Ga0070717_100016061 142
88 3300031238 Ga0265332_10357046 Ga0265332_103570462 142
89 3300031344 Ga0265316_10680648 Ga0265316_106806482 142
90 3300031711 Ga0265314_10005464 Ga0265314_100054644 142
91 3300036647 Ga0316582_0041303 Ga0316582_0041303_247_675 142
92 3300039437 Ga0436365_0953565 Ga0436365_0953565_506_934 142
93 3300044658 Ga0466972_0265545 Ga0466972_0265545_176_604 142
94 3300048912 Ga0496109_0286681 Ga0496109_0286681_1113_1541 142
95 3300049822 Ga0501035_0000974 Ga0501035_0000974_19353_19781 142
96 3300003203 JGI25406J46586_10033938 JGI25406J46586_100339383 143
97 3300005331 Ga0070670_100461405 Ga0070670_1004614052 143
98 3300005337 Ga0070682_100004489 Ga0070682_1000044899 143
99 3300005353 Ga0070669_100008517 Ga0070669_1000085175 143
100 3300005353 Ga0070669_100993335 Ga0070669_1009933352 143
101 3300005354 Ga0070675_101583812 Ga0070675_1015838121 143
102 3300005438 Ga0070701_10406178 Ga0070701_104061782 143
103 3300005444 Ga0070694_100175557 Ga0070694_1001755573 143
104 3300005457 Ga0070662_100605848 Ga0070662_1006058482 143
105 3300005466 Ga0070685_10657025 Ga0070685_106570252 143
106 3300005544 Ga0070686_100002654 Ga0070686_10000265411 143
107 3300005549 Ga0070704_100376854 Ga0070704_1003768542 143
108 3300005577 Ga0068857_100435602 Ga0068857_1004356023 143
109 3300005615 Ga0070702_100527871 Ga0070702_1005278711 143
110 3300005841 Ga0068863_100049208 Ga0068863_1000492085 143
111 3300005841 Ga0068863_100090642 Ga0068863_1000906422 143
112 3300005842 Ga0068858_100378455 Ga0068858_1003784552 143
113 3300005844 Ga0068862_101443683 Ga0068862_1014436831 143
114 3300005937 Ga0081455_10587730 Ga0081455_105877302 143
115 3300005985 Ga0081539_10002031 Ga0081539_1000203125 143
116 3300006028 Ga0070717_10179204 Ga0070717_101792042 143
117 3300006358 Ga0068871_100402448 Ga0068871_1004024482 143
118 3300006844 Ga0075428_102149190 Ga0075428_1021491901 143
119 3300006846 Ga0075430_100274944 Ga0075430_1002749442 143
120 3300006846 Ga0075430_101178811 Ga0075430_1011788111 143
121 3300006847 Ga0075431_100001500 Ga0075431_1000015007 143
122 3300006852 Ga0075433_10058120 Ga0075433_100581201 143
123 3300006852 Ga0075433_10227623 Ga0075433_102276232 143
124 3300006880 Ga0075429_100452061 Ga0075429_1004520612 143
125 3300006931 Ga0097620_100359805 Ga0097620_1003598052 143
126 3300007265 Ga0099794_10040035 Ga0099794_100400352 143
127 3300009093 Ga0105240_10314409 Ga0105240_103144092 143
128 3300009094 Ga0111539_10002964 Ga0111539_1000296414 143
129 3300009094 Ga0111539_10010161 Ga0111539_100101619 143
130 3300009147 Ga0114129_10021850 Ga0114129_100218502 143
131 3300009147 Ga0114129_10487470 Ga0114129_104874702 143
132 3300009147 Ga0114129_11139977 Ga0114129_111399772 143
133 3300009148 Ga0105243_10023036 Ga0105243_100230362 143
134 3300013297 Ga0157378_10321831 Ga0157378_103218312 143
135 3300013297 Ga0157378_10737206 Ga0157378_107372062 143
136 3300013308 Ga0157375_10331017 Ga0157375_103310173 143
137 3300014325 Ga0163163_10711054 Ga0163163_107110542 143
138 3300014326 Ga0157380_10585354 Ga0157380_105853542 143
139 3300014497 Ga0182008_10334748 Ga0182008_103347482 143
140 3300014969 Ga0157376_10021083 Ga0157376_100210832 143
141 3300021384 Ga0213876_10070924 Ga0213876_100709242 143
142 3300025913 Ga0207695_10340853 Ga0207695_103408532 143
143 3300025923 Ga0207681_10001943 Ga0207681_100019435 143
144 3300025925 Ga0207650_10001163 Ga0207650_100011634 143
145 3300025925 Ga0207650_10475397 Ga0207650_104753973 143
146 3300025926 Ga0207659_10700658 Ga0207659_107006582 143
147 3300025933 Ga0207706_10572643 Ga0207706_105726432 143
148 3300025936 Ga0207670_10136301 Ga0207670_101363012 143
149 3300026088 Ga0207641_10042993 Ga0207641_100429933 143
150 3300026088 Ga0207641_10198328 Ga0207641_101983283 143
151 3300030745 Ga0316182_1236488 Ga0316182_12364889 143
152 3300031548 Ga0307408_101583825 Ga0307408_1015838251 143
153 3300032126 Ga0307415_100691874 Ga0307415_1006918742 143
154 3300032133 Ga0316583_10062432 Ga0316583_100624322 143
155 3300036647 Ga0316582_0115094 Ga0316582_0115094_439_870 143
156 3300037418 Ga0395900_0274734 Ga0395900_0274734_632_1063 143
157 3300039437 Ga0436365_1904600 Ga0436365_1904600_718_1149 143
158 3300039437 Ga0436365_1927831 Ga0436365_1927831_5816_6247 143
159 3300041496 Ga0451839_1346987 Ga0451839_1346987_21_452 143
160 3300044712 Ga0453684_0007692 Ga0453684_0007692_6010_6444 143
161 3300044712 Ga0453684_0060420 Ga0453684_0060420_4367_4801 143
162 3300044712 Ga0453684_0356102 Ga0453684_0356102_511_942 143
163 3300044712 Ga0453684_0561343 Ga0453684_0561343_386_820 143
164 3300044712 Ga0453684_0735370 Ga0453684_0735370_508_939 143
165 3300044712 Ga0453684_1451579 Ga0453684_1451579_74_508 143
166 3300046512 Ga0495610_0160497 Ga0495610_0160497_99_566 143
167 3300046616 Ga0495668_0045442 Ga0495668_0045442_646_1113 143
168 3300046674 Ga0495588_0092126 Ga0495588_0092126_1093_1527 143
169 3300047318 Ga0495636_0082319 Ga0495636_0082319_752_1186 143
170 3300048090 Ga0495615_0094429 Ga0495615_0094429_112_546 143
171 3300048911 Ga0496108_1459392 Ga0496108_1459392_34_468 143
172 3300048912 Ga0496109_0000049 Ga0496109_0000049_69786_70217 143
173 3300049574 Ga0501038_0622544 Ga0501038_0622544_302_733 143
174 3300049582 Ga0501048_0595023 Ga0501048_0595023_301_732 143
175 3300049743 Ga0501081_0057720 Ga0501081_0057720_750_1181 143
176 3300050507 nmdc:mga05p37_14882_c1 nmdc:mga05p37_14882_c1_7877_8308 143
177 3300050507 nmdc:mga05p37_417958_c1 nmdc:mga05p37_417958_c1_614_1060 143
178 3300050507 nmdc:mga05p37_748123_c1 nmdc:mga05p37_748123_c1_154_612 143
179 3300050508 nmdc:mga09592_342433_c1 nmdc:mga09592_342433_c1_650_1081 143
180 3300050509 nmdc:mga0qj67_819767_c1 nmdc:mga0qj67_819767_c1_116_547 143
181 3300050510 nmdc:mga06r32_7368_c1 nmdc:mga06r32_7368_c1_6345_6776 143
182 3300050511 nmdc:mga08y16_1131148_c1 nmdc:mga08y16_1131148_c1_90_521 143
183 3300050511 nmdc:mga08y16_192701_c1 nmdc:mga08y16_192701_c1_603_1037 143
184 3300050515 nmdc:mga0a205_405257_c1 nmdc:mga0a205_405257_c1_56_487 143
185 3300050515 nmdc:mga0a205_74926_c1 nmdc:mga0a205_74926_c1_2644_3075 143
186 3300054114 Ga0501084_0208526 Ga0501084_0208526_684_1115 143
187 3300059624 Ga0587109_137927 Ga0587109_137927_16_456 143
188 3300061734 Ga0530510_0066960 Ga0530510_0066960_1170_1601 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

51

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0n-assembly1.cif.gz_D cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.9116 7 128
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.884 42 142
7aeb-assembly1.cif.gz_S cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.8665 25 127
7oyc-assembly1.cif.gz_11 cryo-em structure of the xenopus egg 80s ribosome 0.8655 98 133
5dge-assembly1.cif.gz_f coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome 0.8634 98 135
ID Description Score Start End Superfamily
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.888 42 142 3.10.450.40
af_O13648_363_542_2.70.160.11 Mainly Beta;Distorted Sandwich;Hnrnp arginine n-methyltransferase1;Hnrnp arginine n-methyltransferase1 0.8815 103 136 2.70.160.11
af_A8JQX3_297_620_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8469 96 135 3.60.10.10
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8401 98 135 2.30.30.30
af_I1NCV3_199_405_2.70.160.11 Mainly Beta;Distorted Sandwich;Hnrnp arginine n-methyltransferase1;Hnrnp arginine n-methyltransferase1 0.8377 103 136 2.70.160.11
ID Description Score Start End GO Terms
AF-A0A1H3JDF8-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9631 42 138
AF-A0A2Z3Z422-F1-model_v4 deleted 0.9595 35 137
AF-A0A0A7KPC6-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9566 24 143
AF-A0A7W1PHH8-F1-model_v4 GPW/gp25 family protein 0.9566 25 138
AF-A0A836SDZ9-F1-model_v4 Baseplate protein 0.9542 38 138

Feature Viewer

pLDDT pTM Quality
83.91 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map