F288518

General Info

Members Datasets Scaffolds Average Seq Length
187 127 150 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991442|2819572791
Length 254
Sequence IKGRKNGKRSVEDLKFFLAAADHNYYLCGMSVNLPAYNKVIAELAPHKARLVAVSKVKPAADIQALYDAGQRIFGENYVQELQEKQPILPADIEWHFIGHLQSNKVKYIAPFVSMIHAVDSLRLLEEINKQAARHHRIIHCLLQVHIAEEETKFGLDETELTDLLTQWKDQADKFKNIRIAGFMGMATNTDNMEQVRAEFRHLKALQQQLKASFAPDGDQLTELSIGMSGDYTIALEEGSTMVRIGSMLFGARY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
14 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
15 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
16 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
17 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
18 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
24 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
25 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
29 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
30 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
31 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
32 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
33 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
34 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
35 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
36 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
37 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
38 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
92 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
127 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.68
Metatranscriptomes 0
Isolates 20.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 0
Rhizoplane 1.6
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 20.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1947333 2162886007 Bacteria 1801
2 SwRhRL2b_contig_2019565 2162886007 Bacteria 1547
3 JGI25152J39213_1000867 3300002773 Bacteria 14936
4 JGI25150J39212_1000008 3300002774 Bacteria 253098
5 JGI25151J46595_10000014 3300003187 Bacteria 253098
6 JGI25153J46596_10000020 3300003215 Bacteria 252978
7 rootH1_10008908 3300003316 Bacteria 8519
8 rootH1_10008908 3300003323 Bacteria 11825
9 rootH1_10033040 3300003316 Unclassified 3292
10 rootH1_10147896 3300003316 Bacteria 2096
11 rootH2_10117493 3300003320 Bacteria 1621
12 rootL2_10014037 3300003322 Bacteria 6270
13 rootL2_10044014 3300003322 Bacteria 4665
14 rootL2_10228192 3300003322 Bacteria 2356
15 rootL2_10252524 3300003322 Bacteria 1504
16 rootH1_10094058 3300003323 Bacteria 3374
17 Ga0055536_1000226 3300003781 Bacteria 45469
18 Ga0055530_10003368 3300003791 Bacteria 9150
19 Ga0055531_10000204 3300003794 Bacteria 65068
20 Ga0055531_10000263 3300003794 Bacteria 55230
21 Ga0065165_1012270 3300005262 Bacteria 3501
22 Ga0065714_10002345 3300005288 Bacteria 23040
23 Ga0065714_10003329 3300005288 Bacteria 9982
24 Ga0065714_10010091 3300005288 Bacteria 2988
25 Ga0065714_10016138 3300005288 Bacteria 2287
26 Ga0065714_10068948 3300005288 Bacteria 4448
27 Ga0065714_10134391 3300005288 Bacteria 1220
28 Ga0065714_10198649 3300005288 Bacteria 903
29 Ga0065714_10265988 3300005288 Bacteria 748
30 Ga0065704_10001304 3300005289 Bacteria 9549
31 Ga0065704_10070382 3300005289 Bacteria 27921
32 Ga0065704_10155261 3300005289 Bacteria 1396
33 Ga0070679_100134548 3300005530 Unclassified 2453
34 Ga0068855_100180589 3300005563 Bacteria 2386
35 Ga0068857_100493649 3300005577 Bacteria 1148
36 Ga0075366_10004265 3300006195 Bacteria 7670
37 Ga0105240_10018276 3300009093 Bacteria 9423
38 Ga0105240_10153142 3300009093 Bacteria 2744
39 Ga0105243_10000007 3300009148 Bacteria 445042
40 Ga0105241_10988206 3300009174 Bacteria 787
41 Ga0105242_10219400 3300009176 Bacteria 1699
42 Ga0105237_10000369 3300009545 Bacteria 63892
43 Ga0105237_10004656 3300009545 Bacteria 15799
44 Ga0157373_10002419 3300013100 Bacteria 14191
45 Ga0157373_10006390 3300013100 Bacteria 8806
46 Ga0157373_10046469 3300013100 Bacteria 3098
47 Ga0157371_10000620 3300013102 Bacteria 42287
48 Ga0157371_10004223 3300013102 Bacteria 12636
49 Ga0157371_10005978 3300013102 Bacteria 10152
50 Ga0157370_10000207 3300013104 Bacteria 74451
51 Ga0157370_10011824 3300013104 Bacteria 9107
52 Ga0157370_10018370 3300013104 Bacteria 7033
53 Ga0157370_10019227 3300013104 Bacteria 6860
54 Ga0157370_10065460 3300013104 Bacteria 3439
55 Ga0157370_10460350 3300013104 Bacteria 1169
56 Ga0157369_10000071 3300013105 Bacteria 140377
57 Ga0157374_11417126 3300013296 Bacteria 718
58 Ga0163162_10001708 3300013306 Bacteria 20592
59 Ga0157375_10654780 3300013308 Bacteria 1206
60 Ga0182008_10000009 3300014497 Bacteria 331416
61 Ga0182008_10001007 3300014497 Bacteria 19580
62 Ga0182008_10001946 3300014497 Bacteria 13313
63 Ga0182008_10011417 3300014497 Bacteria 4724
64 Ga0182008_10088545 3300014497 Bacteria 1525
65 Ga0182006_1000332 3300015261 Bacteria 40804
66 Ga0182006_1000356 3300015261 Bacteria 38331
67 Ga0182006_1010749 3300015261 Bacteria 4054
68 Ga0182006_1022120 3300015261 Bacteria 2646
69 Ga0182006_1056465 3300015261 Bacteria 1496
70 Ga0182007_10000006 3300015262 Bacteria 427355
71 Ga0182007_10022679 3300015262 Bacteria 2214
72 Ga0182007_10025165 3300015262 Bacteria 2075
73 Ga0182005_1000056 3300015265 Bacteria 108603
74 Ga0183373_1001 3300015682 Bacteria 1410374
75 Ga0163161_10000309 3300017792 Bacteria 42593
76 Ga0163161_10000394 3300017792 Bacteria 36483
77 Ga0163161_10001366 3300017792 Bacteria 18108
78 Ga0163161_10004577 3300017792 Bacteria 9628
79 Ga0163161_10026670 3300017792 Bacteria 4093
80 Ga0163161_10172453 3300017792 Bacteria 1655
81 Ga0209436_110815 3300025208 Bacteria 1643
82 Ga0207425_1000007 3300025245 Bacteria 777411
83 Ga0209129_1000006 3300025258 Bacteria 777761
84 Ga0209676_1000090 3300025292 Bacteria 256336
85 Ga0209025_1000089 3300025294 Bacteria 254130
86 Ga0209758_1000016 3300025297 Bacteria 778557
87 Ga0209050_1000091 3300025298 Bacteria 253049
88 Ga0207426_1009866 3300025302 Bacteria 3743
89 Ga0209257_1000006 3300025304 Bacteria 1570111
90 Ga0209257_1000025 3300025304 Bacteria 724838
91 Ga0207654_10330651 3300025911 Bacteria 1044
92 Ga0207671_10003237 3300025914 Bacteria 16384
93 Ga0207671_10011917 3300025914 Bacteria 7030
94 Ga0207652_10218636 3300025921 Unclassified 1717
95 Ga0207686_10147471 3300025934 Bacteria 1634
96 Ga0207709_10000049 3300025935 Bacteria 237124
97 Ga0207667_10279974 3300025949 Bacteria 1704
98 Ga0307515_10088611 3300028794 Bacteria 3909
99 Ga0316177_1106149 3300030731 Bacteria 6319
100 Ga0316176_1037419 3300030732 Bacteria 4346
101 Ga0316183_1205599 3300030742 Bacteria 27167
102 Ga0316181_1034648 3300030744 Unclassified 2367
103 Ga0316181_1062778 3300030744 Bacteria 2050
104 Ga0316182_1274545 3300030745 Bacteria 1571
105 Ga0307405_10000012 3300031731 Bacteria 233774
106 Ga0307405_10073848 3300031731 Bacteria 2203
107 Ga0307413_10290913 3300031824 Bacteria 1234
108 Ga0307407_10000013 3300031903 Bacteria 165614
109 Ga0307412_10000084 3300031911 Bacteria 90908
110 Ga0307416_100000028 3300032002 Bacteria 165572
111 Ga0307414_10005153 3300032004 Bacteria 7169
112 Ga0307414_10036437 3300032004 Bacteria 3284
113 Ga0307414_10154396 3300032004 Bacteria 1815
114 Ga0307414_10246754 3300032004 Bacteria 1481
115 Ga0307414_10277780 3300032004 Bacteria 1406
116 Ga0307414_10353094 3300032004 Bacteria 1263
117 Ga0307411_10035740 3300032005 Unclassified 3106
118 Ga0451855_2021065 3300041511 Bacteria 661
119 Ga0451577_0022385 3300042876 Bacteria 5770
120 Ga0453684_0108567 3300044712 Bacteria 3377
121 Ga0453684_0430273 3300044712 Bacteria 1472
122 Ga0495627_010375 3300046453 Bacteria 3389
123 Ga0495606_0036741 3300046507 Bacteria 3333
124 Ga0495606_0146215 3300046507 Bacteria 1391
125 Ga0495610_0000060 3300046512 Bacteria 131116
126 Ga0495610_0002356 3300046512 Bacteria 15967
127 Ga0495644_0011577 3300046523 Bacteria 3395
128 Ga0495609_0084453 3300046538 Bacteria 1385
129 Ga0495633_0000529 3300046558 Bacteria 38115
130 Ga0495633_0139061 3300046558 Bacteria 1123
131 Ga0495681_0129640 3300047470 Bacteria 1074
132 Ga0496100_0557150 3300048903 Bacteria 887
133 Ga0496101_0597812 3300048904 Bacteria 872
134 Ga0496115_0071722 3300048918 Bacteria 2809
135 Ga0496116_0006790 3300048919 Bacteria 10295
136 Ga0496117_0007250 3300048920 Bacteria 10899
137 Ga0496118_0038305 3300048921 Bacteria 3845
138 Ga0496121_0000028 3300048924 Bacteria 439193
139 Ga0496122_0001846 3300048925 Bacteria 32295
140 Ga0496122_0011826 3300048925 Bacteria 8775
141 Ga0496123_0002062 3300048926 Bacteria 25924
142 Ga0496123_0016849 3300048926 Bacteria 5907
143 Ga0496126_0538289 3300048929 Bacteria 928
144 Ga0501252_018798 3300049682 Bacteria 888
145 Ga0501241_000400 3300049758 Bacteria 9516
146 Ga0501241_002366 3300049758 Bacteria 3648
147 Ga0500651_0002353 3300053093 Bacteria 9943
148 Ga0500651_0064640 3300053093 Bacteria 2281
149 Ga0500622_0001257 3300053156 Bacteria 20711
150 Ga0500622_0004747 3300053156 Bacteria 8376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_2021065 Ga0451855_2021065_26_634 201
2 3300009176 Ga0105242_10219400 Ga0105242_102194002 202
3 3300025934 Ga0207686_10147471 Ga0207686_101474712 202
4 3300031824 Ga0307413_10290913 Ga0307413_102909132 202
5 3300053156 Ga0500622_0004747 Ga0500622_0004747_3790_4467 205
6 3300003316 rootH1_10033040 rootH1_100330403 209
7 3300003794 Ga0055531_10000204 Ga0055531_1000020427 209
8 3300025304 Ga0209257_1000006 Ga0209257_1000006934 209
9 3300044712 Ga0453684_0430273 Ga0453684_0430273_192_863 209
10 3300049682 Ga0501252_018798 Ga0501252_018798_98_790 211
11 iso_pu_bacteria 2833640130 2833644146 214
12 3300015262 Ga0182007_10022679 Ga0182007_100226793 215
13 iso_pu_bacteria 8036736890 8036738088 215
14 3300042876 Ga0451577_0022385 Ga0451577_0022385_5052_5741 216
15 iso_pu_bacteria 2958512119 2958512608 216
16 3300014497 Ga0182008_10011417 Ga0182008_100114171 217
17 3300014497 Ga0182008_10088545 Ga0182008_100885453 217
18 3300015262 Ga0182007_10025165 Ga0182007_100251653 217
19 iso_pu_bacteria 2883068021 2883069419 217
20 iso_pu_bacteria 2896085136 2896088150 217
21 iso_pu_bacteria 2929239360 2929244695 217
22 3300032005 Ga0307411_10035740 Ga0307411_100357402 219
23 iso_pu_bacteria 2821136567 2821139796 219
24 iso_pu_bacteria 2904467357 2904473453 219
25 3300003320 rootH2_10117493 rootH2_101174931 220
26 3300003322 rootL2_10252524 rootL2_102525242 220
27 3300046507 Ga0495606_0146215 Ga0495606_0146215_274_945 220
28 3300030731 Ga0316177_1106149 Ga0316177_11061491 221
29 3300030732 Ga0316176_1037419 Ga0316176_10374193 221
30 3300030742 Ga0316183_1205599 Ga0316183_12055992 221
31 3300030744 Ga0316181_1034648 Ga0316181_10346481 221
32 3300032004 Ga0307414_10277780 Ga0307414_102777802 221
33 3300003316 rootH1_10008908 rootH1_100089083 222
34 3300003316 rootH1_10147896 rootH1_101478964 222
35 3300003322 rootL2_10014037 rootL2_100140372 222
36 3300003322 rootL2_10044014 rootL2_100440143 222
37 3300003322 rootL2_10228192 rootL2_102281922 222
38 3300003323 rootH1_10094058 rootH1_100940584 222
39 3300003794 Ga0055531_10000263 Ga0055531_1000026354 222
40 3300005262 Ga0065165_1012270 Ga0065165_10122701 222
41 3300015265 Ga0182005_1000056 Ga0182005_10000568 222
42 3300025208 Ga0209436_110815 Ga0209436_1108153 222
43 3300025302 Ga0207426_1009866 Ga0207426_10098663 222
44 3300025304 Ga0209257_1000025 Ga0209257_1000025246 222
45 3300044712 Ga0453684_0108567 Ga0453684_0108567_2416_3096 222
46 3300046453 Ga0495627_010375 Ga0495627_010375_1119_1796 222
47 3300046558 Ga0495633_0000529 Ga0495633_0000529_27420_28097 222
48 3300048903 Ga0496100_0557150 Ga0496100_0557150_86_763 222
49 3300048904 Ga0496101_0597812 Ga0496101_0597812_86_763 222
50 3300048924 Ga0496121_0000028 Ga0496121_0000028_93627_94304 222
51 3300048929 Ga0496126_0538289 Ga0496126_0538289_159_836 222
52 3300049758 Ga0501241_000400 Ga0501241_000400_6459_7136 222
53 3300053093 Ga0500651_0064640 Ga0500651_0064640_353_1030 222
54 iso_pu_bacteria 2818991442 2819572791 222
55 iso_pu_bacteria 2738541283 2738757177 225
56 iso_pu_bacteria 2738541284 2738762791 225
57 iso_pu_bacteria 2739367663 2739644864 225
58 iso_pu_bacteria 2775506987 2776614355 225
59 iso_pu_bacteria 2852627209 2852630265 225
60 iso_pu_bacteria 2890737413 2890740492 225
61 iso_pu_bacteria 2896344016 2896345035 225
62 iso_pu_bacteria 2919186247 2919190032 225
63 iso_pu_bacteria 2939664404 2939668313 225
64 3300015261 Ga0182006_1056465 Ga0182006_10564652 226
65 iso_pu_bacteria 2585427687 2586208601 226
66 iso_pu_bacteria 2721755487 2722728448 226
67 iso_pu_bacteria 2738541302 2738852995 226
68 iso_pu_bacteria 2738543023 2739300468 226
69 iso_pu_bacteria 2739367651 2739586367 226
70 iso_pu_bacteria 2739367656 2739617760 226
71 iso_pu_bacteria 2818991437 2819549127 226
72 iso_pu_bacteria 2842722452 2842725623 226
73 iso_pu_bacteria 2842909656 2842914447 226
74 iso_pu_bacteria 2849281842 2849283019 226
75 iso_pu_bacteria 2857627736 2857630649 226
76 iso_pu_bacteria 2896317667 2896318058 226
77 iso_pu_bacteria 2902048731 2902048892 226
78 iso_pu_bacteria 2904445276 2904449203 226
79 iso_pu_bacteria 2904780799 2904785219 226
80 iso_pu_bacteria 2919177583 2919181039 226
81 iso_pu_bacteria 2945997725 2946001142 226
82 iso_pu_bacteria 2954016120 2954018042 226
83 iso_pu_bacteria 2977232053 2977233222 226
84 3300013100 Ga0157373_10002419 Ga0157373_1000241912 228
85 3300013308 Ga0157375_10654780 Ga0157375_106547802 228
86 3300017792 Ga0163161_10000394 Ga0163161_1000039418 228
87 3300032004 Ga0307414_10005153 Ga0307414_100051533 228
88 3300046538 Ga0495609_0084453 Ga0495609_0084453_360_1046 228
89 2162886007 SwRhRL2b_contig_2019565 SwRhRL2b_0111.00007640 229
90 3300005288 Ga0065714_10002345 Ga0065714_1000234512 229
91 3300005288 Ga0065714_10003329 Ga0065714_100033292 229
92 3300005289 Ga0065704_10070382 Ga0065704_1007038210 229
93 3300005289 Ga0065704_10155261 Ga0065704_101552611 229
94 3300005530 Ga0070679_100134548 Ga0070679_1001345483 229
95 3300005577 Ga0068857_100493649 Ga0068857_1004936491 229
96 3300009093 Ga0105240_10018276 Ga0105240_100182769 229
97 3300009093 Ga0105240_10153142 Ga0105240_101531423 229
98 3300009174 Ga0105241_10988206 Ga0105241_109882061 229
99 3300009545 Ga0105237_10000369 Ga0105237_1000036960 229
100 3300009545 Ga0105237_10004656 Ga0105237_100046564 229
101 3300013100 Ga0157373_10006390 Ga0157373_100063908 229
102 3300013102 Ga0157371_10004223 Ga0157371_100042231 229
103 3300013102 Ga0157371_10005978 Ga0157371_100059789 229
104 3300013104 Ga0157370_10000207 Ga0157370_1000020715 229
105 3300013104 Ga0157370_10065460 Ga0157370_100654605 229
106 3300013104 Ga0157370_10460350 Ga0157370_104603502 229
107 3300013296 Ga0157374_11417126 Ga0157374_114171261 229
108 3300014497 Ga0182008_10000009 Ga0182008_10000009167 229
109 3300014497 Ga0182008_10001007 Ga0182008_1000100718 229
110 3300015261 Ga0182006_1000332 Ga0182006_100033221 229
111 3300015261 Ga0182006_1022120 Ga0182006_10221203 229
112 3300017792 Ga0163161_10004577 Ga0163161_100045774 229
113 3300017792 Ga0163161_10172453 Ga0163161_101724533 229
114 3300025911 Ga0207654_10330651 Ga0207654_103306511 229
115 3300025914 Ga0207671_10003237 Ga0207671_100032373 229
116 3300025914 Ga0207671_10011917 Ga0207671_100119173 229
117 3300025921 Ga0207652_10218636 Ga0207652_102186361 229
118 3300030744 Ga0316181_1062778 Ga0316181_10627783 229
119 3300030745 Ga0316182_1274545 Ga0316182_12745452 229
120 3300031731 Ga0307405_10073848 Ga0307405_100738482 229
121 3300031911 Ga0307412_10000084 Ga0307412_1000008419 229
122 3300032004 Ga0307414_10036437 Ga0307414_100364373 229
123 3300032004 Ga0307414_10154396 Ga0307414_101543962 229
124 3300032004 Ga0307414_10246754 Ga0307414_102467542 229
125 3300032004 Ga0307414_10353094 Ga0307414_103530942 229
126 3300046507 Ga0495606_0036741 Ga0495606_0036741_2594_3283 229
127 3300046523 Ga0495644_0011577 Ga0495644_0011577_2188_2877 229
128 3300048925 Ga0496122_0001846 Ga0496122_0001846_21592_22281 229
129 3300048926 Ga0496123_0002062 Ga0496123_0002062_5933_6622 229
130 3300049758 Ga0501241_002366 Ga0501241_002366_1158_1847 229
131 3300053093 Ga0500651_0002353 Ga0500651_0002353_293_982 229
132 3300053156 Ga0500622_0001257 Ga0500622_0001257_17661_18350 229
133 2162886007 SwRhRL2b_contig_1947333 SwRhRL2b_0983.00002610 230
134 3300002773 JGI25152J39213_1000867 JGI25152J39213_10008676 230
135 3300002774 JGI25150J39212_1000008 JGI25150J39212_100000886 230
136 3300003187 JGI25151J46595_10000014 JGI25151J46595_1000001486 230
137 3300003215 JGI25153J46596_10000020 JGI25153J46596_1000002086 230
138 3300003781 Ga0055536_1000226 Ga0055536_10002269 230
139 3300003791 Ga0055530_10003368 Ga0055530_100033689 230
140 3300005288 Ga0065714_10010091 Ga0065714_100100913 230
141 3300005288 Ga0065714_10016138 Ga0065714_100161381 230
142 3300005288 Ga0065714_10068948 Ga0065714_100689485 230
143 3300005288 Ga0065714_10134391 Ga0065714_101343911 230
144 3300005288 Ga0065714_10198649 Ga0065714_101986491 230
145 3300005288 Ga0065714_10265988 Ga0065714_102659881 230
146 3300005289 Ga0065704_10001304 Ga0065704_100013046 230
147 3300005563 Ga0068855_100180589 Ga0068855_1001805892 230
148 3300006195 Ga0075366_10004265 Ga0075366_100042654 230
149 3300009148 Ga0105243_10000007 Ga0105243_10000007219 230
150 3300013100 Ga0157373_10046469 Ga0157373_100464692 230
151 3300013102 Ga0157371_10000620 Ga0157371_1000062033 230
152 3300013104 Ga0157370_10011824 Ga0157370_100118246 230
153 3300013104 Ga0157370_10018370 Ga0157370_100183701 230
154 3300013104 Ga0157370_10019227 Ga0157370_100192271 230
155 3300013105 Ga0157369_10000071 Ga0157369_1000007120 230
156 3300013306 Ga0163162_10001708 Ga0163162_1000170813 230
157 3300014497 Ga0182008_10001946 Ga0182008_1000194613 230
158 3300015261 Ga0182006_1000356 Ga0182006_10003568 230
159 3300015261 Ga0182006_1010749 Ga0182006_10107493 230
160 3300015262 Ga0182007_10000006 Ga0182007_10000006299 230
161 3300015682 Ga0183373_1001 Ga0183373_10011140 230
162 3300017792 Ga0163161_10000309 Ga0163161_100003099 230
163 3300017792 Ga0163161_10001366 Ga0163161_1000136610 230
164 3300017792 Ga0163161_10026670 Ga0163161_100266702 230
165 3300025245 Ga0207425_1000007 Ga0207425_100000789 230
166 3300025258 Ga0209129_1000006 Ga0209129_100000689 230
167 3300025292 Ga0209676_1000090 Ga0209676_100009031 230
168 3300025294 Ga0209025_1000089 Ga0209025_100008983 230
169 3300025297 Ga0209758_1000016 Ga0209758_100001689 230
170 3300025298 Ga0209050_1000091 Ga0209050_100009131 230
171 3300025935 Ga0207709_10000049 Ga0207709_10000049174 230
172 3300025949 Ga0207667_10279974 Ga0207667_102799742 230
173 3300028794 Ga0307515_10088611 Ga0307515_100886112 230
174 3300031731 Ga0307405_10000012 Ga0307405_1000001214 230
175 3300031903 Ga0307407_10000013 Ga0307407_10000013136 230
176 3300032002 Ga0307416_100000028 Ga0307416_100000028136 230
177 3300046512 Ga0495610_0000060 Ga0495610_0000060_5561_6262 230
178 3300046512 Ga0495610_0002356 Ga0495610_0002356_13516_14217 230
179 3300046558 Ga0495633_0139061 Ga0495633_0139061_262_963 230
180 3300047470 Ga0495681_0129640 Ga0495681_0129640_243_944 230
181 3300048918 Ga0496115_0071722 Ga0496115_0071722_2039_2734 230
182 3300048919 Ga0496116_0006790 Ga0496116_0006790_3554_4246 230
183 3300048920 Ga0496117_0007250 Ga0496117_0007250_6217_6909 230
184 3300048921 Ga0496118_0038305 Ga0496118_0038305_584_1276 230
185 3300048925 Ga0496122_0011826 Ga0496122_0011826_4408_5100 230
186 3300048926 Ga0496123_0016849 Ga0496123_0016849_2336_3028 230
187 iso_pu_bacteria 3003233435 3003233870 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

35

254

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ygf-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9328 1 218
7f8e-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9327 1 218
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.922 2 219
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.9179 2 219
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9125 2 220
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9116 2 220 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9089 2 219 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9048 2 219 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8837 4 221 3.20.20.10
af_A0A1D8PE30_36_277_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8827 2 221 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A1H7WDK4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9995 1 221 GO:0030170
AF-A0A7C5M204-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9966 23 221 GO:0030170
AF-A0A1H7WDK4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.995 1 221 GO:0030170
AF-A0A258KE01-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9929 48 226 GO:0030170
AF-A0A7D4BKV5-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9928 1 222 GO:0030170

Feature Viewer

pLDDT pTM Quality
94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map