F288412

General Info

Members Datasets Scaffolds Average Seq Length
187 151 153 231

Family's Representative Sequence

Representative Sequence 3300049761|Ga0501264_000268|Ga0501264_000268_6714_7568
Length 272
Sequence VIYVLIKDATTRHLCIVIIQKKRMKTGRNILLTAVLLLQIFTAYAQSAILFVLTSHDQLGNTGEKTGFWIEEFASPYYALTDQGIDVTIASPKGGQPPIDPKSNLPEFSTPSTKRFNGDPQTQNKLAHTVTLKDVDQKNFDAVFYPGGHGPLWDLAEDKRSIQLIESFYNNNKPIAFVCHAPGVLKNVKDKTGAYLVKGKKVTGFKNTEEAAVQLTDVVPFLLEDVLKQNGAEFQSGDDWKPFVVADGLLITGQNPASSEAVAEKLVEYLKR

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231022 Pseudomonas sp. GM79 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
10 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
11 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
12 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
13 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
14 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
15 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
16 2643221569 Achromobacter sp. Root565 Isolate Unclassified
17 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
18 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
19 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
20 2738541283 Pedobacter sp. OK701 Isolate Unclassified
21 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
22 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
23 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
24 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
25 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
26 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
27 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
28 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
29 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
30 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
31 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
70 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
71 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
72 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
73 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
74 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
75 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
136 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
137 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
142 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
151 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.28
Metatranscriptomes 0.53
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 4.81
Rhizoplane 1.6
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10033260 3300003316 Bacteria 32873
2 rootH1_10073884 3300003316 Bacteria 5031
3 rootH2_10153571 3300003320 Bacteria 1701
4 rootH2_10180610 3300003320 Bacteria 1460
5 rootL2_10053297 3300003322 Bacteria 5688
6 rootH1_10006905 3300003323 Bacteria 4155
7 rootH1_10054477 3300003323 Bacteria 26781
8 Ga0055526_1001971 3300003771 Bacteria 14170
9 Ga0055526_1004436 3300003771 Bacteria 8432
10 Ga0055536_1000879 3300003781 Bacteria 19531
11 Ga0055534_1000199 3300003784 Bacteria 44113
12 Ga0068856_100040676 3300005614 Bacteria 4567
13 Ga0068863_100364484 3300005841 Bacteria 1409
14 Ga0070717_10665013 3300006028 Bacteria 946
15 Ga0068871_100343613 3300006358 Bacteria 1318
16 Ga0097620_100273726 3300006931 Bacteria 1781
17 Ga0157370_10386598 3300013104 Bacteria 1288
18 Ga0157372_10265683 3300013307 Bacteria 1993
19 Ga0182008_10024426 3300014497 Bacteria 3078
20 Ga0182007_10010844 3300015262 Bacteria 3578
21 Ga0206350_11609373 3300020080 Bacteria 1026
22 Ga0213872_10035388 3300021361 Bacteria 2284
23 Ga0213872_10073062 3300021361 Bacteria 1545
24 Ga0209675_1000087 3300025291 Bacteria 147632
25 Ga0209676_1000144 3300025292 Bacteria 175244
26 Ga0209025_1000046 3300025294 Bacteria 348962
27 Ga0209564_1000276 3300025295 Bacteria 106851
28 Ga0209564_1000434 3300025295 Bacteria 72534
29 Ga0207667_10102461 3300025949 Bacteria 2953
30 Ga0307408_100165398 3300031548 Bacteria 1761
31 Ga0307408_100422392 3300031548 Bacteria 1150
32 Ga0307405_10635394 3300031731 Bacteria 876
33 Ga0307413_10100640 3300031824 Bacteria 1909
34 Ga0307410_10170152 3300031852 Bacteria 1641
35 Ga0307406_10132212 3300031901 Bacteria 1754
36 Ga0307412_10420571 3300031911 Bacteria 1093
37 Ga0307409_100614649 3300031995 Bacteria 1076
38 Ga0307409_100898639 3300031995 Bacteria 899
39 Ga0307416_100315534 3300032002 Bacteria 1562
40 Ga0307414_10075369 3300032004 Bacteria 2448
41 Ga0307414_10766883 3300032004 Bacteria 878
42 Ga0307411_10229148 3300032005 Bacteria 1447
43 Ga0373931_0029497 3300035691 Bacteria 2817
44 Ga0395905_0000242 3300037471 Bacteria 82835
45 Ga0400488_24272 3300038741 Bacteria 1772
46 Ga0436361_0074731 3300039447 Bacteria 12211
47 Ga0436361_0494143 3300039447 Bacteria 19325
48 Ga0436361_0664887 3300039447 Bacteria 6560
49 Ga0439432_051380 3300042006 Bacteria 1285
50 Ga0439451_000868 3300042009 Bacteria 5793
51 Ga0439451_001825 3300042009 Bacteria 4261
52 Ga0439451_007054 3300042009 Bacteria 2296
53 Ga0450919_000233 3300042121 Bacteria 6238
54 Ga0450890_002439 3300042127 Bacteria 2560
55 Ga0450903_003472 3300042138 Bacteria 2728
56 Ga0450906_009544 3300042145 Bacteria 1848
57 Ga0450907_000635 3300042146 Bacteria 9293
58 Ga0439464_0038048 3300042439 Bacteria 1366
59 Ga0450918_000062 3300042531 Bacteria 21831
60 Ga0495617_000521 3300046452 Bacteria 19980
61 Ga0495590_0005377 3300046457 Bacteria 5081
62 Ga0495638_0004808 3300046460 Bacteria 10176
63 Ga0495650_0007755 3300046471 Bacteria 6387
64 Ga0495584_0012082 3300046491 Bacteria 4413
65 Ga0495584_0069805 3300046491 Bacteria 1765
66 Ga0495607_0002149 3300046501 Bacteria 16436
67 Ga0495607_0025796 3300046501 Bacteria 3652
68 Ga0495583_0001124 3300046506 Bacteria 29443
69 Ga0495583_0094145 3300046506 Bacteria 1286
70 Ga0495616_0001316 3300046513 Bacteria 17332
71 Ga0495632_0014622 3300046519 Bacteria 4432
72 Ga0495632_0118491 3300046519 Bacteria 1238
73 Ga0495637_0014334 3300046520 Bacteria 3739
74 Ga0495643_0003926 3300046522 Bacteria 10652
75 Ga0495643_0016760 3300046522 Bacteria 4300
76 Ga0495648_0165798 3300046524 Bacteria 1137
77 Ga0495642_0006938 3300046528 Bacteria 4345
78 Ga0495609_0011149 3300046538 Bacteria 4290
79 Ga0495633_0134772 3300046558 Bacteria 1142
80 Ga0495611_0002085 3300046648 Bacteria 9397
81 Ga0495659_0034139 3300046664 Bacteria 1788
82 Ga0495670_0132071 3300046691 Bacteria 1302
83 Ga0495671_0068016 3300046692 Bacteria 1751
84 Ga0495649_0001819 3300046694 Bacteria 15663
85 Ga0495649_0078887 3300046694 Bacteria 1761
86 Ga0495589_0000222 3300046794 Bacteria 48332
87 Ga0495600_0022884 3300046809 Bacteria 4017
88 Ga0495660_0159540 3300046810 Bacteria 1107
89 Ga0495604_0091551 3300047317 Bacteria 2255
90 Ga0495636_0003530 3300047318 Bacteria 6061
91 Ga0495672_0002817 3300047320 Bacteria 15489
92 Ga0495672_0004319 3300047320 Bacteria 11706
93 Ga0495683_0017102 3300047323 Bacteria 3761
94 Ga0495687_011128 3300047443 Bacteria 4861
95 Ga0495677_0000170 3300047445 Bacteria 31449
96 Ga0495677_0005180 3300047445 Bacteria 4959
97 Ga0495685_034119 3300047447 Bacteria 1748
98 Ga0495673_0012551 3300047469 Bacteria 4485
99 Ga0495684_0175704 3300047471 Bacteria 1590
100 Ga0495686_0001186 3300047472 Bacteria 30396
101 Ga0495626_0012026 3300048091 Bacteria 4554
102 Ga0495626_0065199 3300048091 Bacteria 1648
103 Ga0495626_0102054 3300048091 Bacteria 1249
104 Ga0496110_0000519 3300048913 Bacteria 26219
105 Ga0496111_0164083 3300048914 Bacteria 1650
106 Ga0496116_0219136 3300048919 Bacteria 977
107 Ga0496123_0022254 3300048926 Bacteria 4892
108 Ga0496125_0040852 3300048928 Bacteria 3973
109 Ga0495678_010401 3300049459 Bacteria 4526
110 Ga0495678_106818 3300049459 Bacteria 961
111 Ga0495682_0080879 3300049460 Bacteria 1168
112 Ga0501036_0088455 3300049572 Bacteria 2618
113 Ga0501036_0771574 3300049572 Bacteria 792
114 Ga0501037_0140421 3300049573 Bacteria 1729
115 Ga0501038_0095256 3300049574 Bacteria 2487
116 Ga0501039_0257414 3300049575 Bacteria 1372
117 Ga0501040_0038514 3300049576 Bacteria 3250
118 Ga0501040_0428752 3300049576 Bacteria 951
119 Ga0501041_0021717 3300049577 Bacteria 3844
120 Ga0501041_0213169 3300049577 Bacteria 1211
121 Ga0501042_0093244 3300049578 Bacteria 2162
122 Ga0501043_0360245 3300049579 Bacteria 1104
123 Ga0501046_0039970 3300049580 Bacteria 3752
124 Ga0501048_0062023 3300049582 Bacteria 2647
125 Ga0501048_0104477 3300049582 Bacteria 1999
126 Ga0501070_0713624 3300049586 Bacteria 792
127 Ga0501071_0039724 3300049587 Bacteria 3366
128 Ga0501071_0236100 3300049587 Bacteria 1378
129 Ga0501072_0356839 3300049588 Bacteria 1160
130 Ga0501075_0037095 3300049591 Bacteria 3640
131 Ga0501076_0017382 3300049592 Bacteria 5466
132 Ga0501076_0485074 3300049592 Bacteria 1018
133 Ga0501077_0314780 3300049593 Bacteria 998
134 Ga0501077_0524915 3300049593 Bacteria 759
135 Ga0501233_011288 3300049668 Bacteria 1774
136 Ga0501236_014242 3300049670 Bacteria 1098
137 Ga0501247_011431 3300049677 Bacteria 1070
138 Ga0501257_003187 3300049686 Bacteria 3497
139 Ga0501080_0008804 3300049742 Bacteria 9173
140 Ga0501081_0109631 3300049743 Bacteria 1958
141 Ga0501081_0339848 3300049743 Bacteria 1105
142 Ga0501264_000268 3300049761 Bacteria 8181
143 Ga0501272_020227 3300049769 Bacteria 796
144 Ga0501035_0523772 3300049822 Bacteria 974
145 Ga0501035_0680079 3300049822 Bacteria 832
146 Ga0500618_003878 3300053125 Bacteria 4978
147 Ga0500627_0055528 3300053158 Bacteria 1734
148 Ga0500645_071722 3300053730 Bacteria 994
149 Ga0501084_0309410 3300054114 Bacteria 1334
150 Ga0501084_0339291 3300054114 Bacteria 1269
151 Ga0501082_0032220 3300060353 Bacteria 4520
152 Ga0530510_0031070 3300061734 Bacteria 3839
153 Ga0530510_0060003 3300061734 Bacteria 2752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10665013 Ga0070717_106650131 209
2 3300046506 Ga0495583_0001124 Ga0495583_0001124_3514_4173 219
3 iso_pu_bacteria 2524023209 2524460130 220
4 iso_pu_bacteria 2842298080 2842298644 220
5 iso_pu_bacteria 2842357229 2842359489 220
6 3300042009 Ga0439451_007054 Ga0439451_007054_12_677 221
7 3300049582 Ga0501048_0062023 Ga0501048_0062023_324_989 221
8 iso_pu_bacteria 2511231004 2511255344 221
9 iso_pu_bacteria 2511231016 2511328381 221
10 iso_pu_bacteria 2511231022 2511364133 221
11 iso_pu_bacteria 2523533629 2524005717 221
12 iso_pu_bacteria 2582581299 2585228070 221
13 iso_pu_bacteria 2643221634 2644195664 221
14 iso_pu_bacteria 2881927736 2881930925 221
15 iso_pu_bacteria 2929177148 2929180858 221
16 iso_pu_bacteria 2945977869 2945983258 221
17 iso_pu_bacteria 2946013367 2946017352 221
18 iso_pu_bacteria 2643221569 2643859544 222
19 iso_pu_bacteria 2738541283 2738756480 222
20 iso_pu_bacteria 2501025501 2501072067 223
21 iso_pu_bacteria 2501025504 2501411874 223
22 iso_pu_bacteria 2510917014 2511100877 223
23 iso_pu_bacteria 2510917015 2511107364 223
24 iso_pu_bacteria 2513237083 2513564971 223
25 iso_pu_bacteria 2515154189 2516020399 223
26 iso_pu_bacteria 2721755763 2723878037 223
27 iso_pu_bacteria 2842698319 2842699096 223
28 iso_pu_bacteria 2883087390 2883089544 223
29 iso_pu_bacteria 2916178963 2916180307 223
30 iso_pu_bacteria 8003955200 8003960342 223
31 3300047320 Ga0495672_0002817 Ga0495672_0002817_4321_4995 224
32 3300049459 Ga0495678_106818 Ga0495678_106818_97_771 224
33 iso_pu_bacteria 2599185292 2599902154 224
34 iso_pu_bacteria 2643221644 2644248330 224
35 iso_pu_bacteria 2808606379 2808943013 224
36 3300003320 rootH2_10153571 rootH2_101535711 225
37 3300003323 rootH1_10006905 rootH1_100069054 225
38 3300031731 Ga0307405_10635394 Ga0307405_106353941 225
39 3300031995 Ga0307409_100898639 Ga0307409_1008986391 225
40 3300038741 Ga0400488_24272 Ga0400488_24272_238_915 225
41 3300042006 Ga0439432_051380 Ga0439432_051380_293_970 225
42 3300042009 Ga0439451_000868 Ga0439451_000868_4426_5103 225
43 3300042009 Ga0439451_001825 Ga0439451_001825_2607_3284 225
44 3300042127 Ga0450890_002439 Ga0450890_002439_1391_2068 225
45 3300042138 Ga0450903_003472 Ga0450903_003472_1450_2127 225
46 3300042145 Ga0450906_009544 Ga0450906_009544_712_1389 225
47 3300042146 Ga0450907_000635 Ga0450907_000635_726_1403 225
48 3300042439 Ga0439464_0038048 Ga0439464_0038048_657_1334 225
49 3300046452 Ga0495617_000521 Ga0495617_000521_18259_18936 225
50 3300046457 Ga0495590_0005377 Ga0495590_0005377_3680_4357 225
51 3300046471 Ga0495650_0007755 Ga0495650_0007755_5187_5864 225
52 3300046491 Ga0495584_0012082 Ga0495584_0012082_735_1412 225
53 3300046491 Ga0495584_0069805 Ga0495584_0069805_740_1417 225
54 3300046501 Ga0495607_0002149 Ga0495607_0002149_1964_2641 225
55 3300046501 Ga0495607_0025796 Ga0495607_0025796_491_1168 225
56 3300046506 Ga0495583_0094145 Ga0495583_0094145_228_905 225
57 3300046513 Ga0495616_0001316 Ga0495616_0001316_16121_16798 225
58 3300046519 Ga0495632_0014622 Ga0495632_0014622_3001_3678 225
59 3300046520 Ga0495637_0014334 Ga0495637_0014334_230_907 225
60 3300046522 Ga0495643_0016760 Ga0495643_0016760_727_1404 225
61 3300046524 Ga0495648_0165798 Ga0495648_0165798_335_1012 225
62 3300046528 Ga0495642_0006938 Ga0495642_0006938_3015_3692 225
63 3300046538 Ga0495609_0011149 Ga0495609_0011149_2251_2928 225
64 3300046558 Ga0495633_0134772 Ga0495633_0134772_383_1060 225
65 3300046648 Ga0495611_0002085 Ga0495611_0002085_738_1415 225
66 3300046664 Ga0495659_0034139 Ga0495659_0034139_705_1382 225
67 3300046691 Ga0495670_0132071 Ga0495670_0132071_439_1116 225
68 3300046692 Ga0495671_0068016 Ga0495671_0068016_349_1026 225
69 3300046694 Ga0495649_0001819 Ga0495649_0001819_14233_14910 225
70 3300046794 Ga0495589_0000222 Ga0495589_0000222_748_1425 225
71 3300046810 Ga0495660_0159540 Ga0495660_0159540_389_1066 225
72 3300047318 Ga0495636_0003530 Ga0495636_0003530_1945_2622 225
73 3300047320 Ga0495672_0004319 Ga0495672_0004319_8114_8791 225
74 3300047323 Ga0495683_0017102 Ga0495683_0017102_182_859 225
75 3300047443 Ga0495687_011128 Ga0495687_011128_1067_1744 225
76 3300047447 Ga0495685_034119 Ga0495685_034119_347_1024 225
77 3300047469 Ga0495673_0012551 Ga0495673_0012551_631_1308 225
78 3300048091 Ga0495626_0012026 Ga0495626_0012026_3133_3810 225
79 3300048091 Ga0495626_0102054 Ga0495626_0102054_224_901 225
80 3300049459 Ga0495678_010401 Ga0495678_010401_751_1428 225
81 3300049460 Ga0495682_0080879 Ga0495682_0080879_476_1153 225
82 3300003771 Ga0055526_1001971 Ga0055526_100197113 226
83 3300003771 Ga0055526_1004436 Ga0055526_10044366 226
84 3300003781 Ga0055536_1000879 Ga0055536_10008795 226
85 3300003784 Ga0055534_1000199 Ga0055534_100019933 226
86 3300025291 Ga0209675_1000087 Ga0209675_100008787 226
87 3300025292 Ga0209676_1000144 Ga0209676_10001445 226
88 3300025294 Ga0209025_1000046 Ga0209025_1000046175 226
89 3300025295 Ga0209564_1000276 Ga0209564_100027650 226
90 3300025295 Ga0209564_1000434 Ga0209564_100043455 226
91 3300032004 Ga0307414_10075369 Ga0307414_100753692 226
92 3300035691 Ga0373931_0029497 Ga0373931_0029497_1026_1706 226
93 3300048928 Ga0496125_0040852 Ga0496125_0040852_3035_3715 226
94 iso_pu_bacteria 8002745576 8002747017 226
95 3300005841 Ga0068863_100364484 Ga0068863_1003644842 227
96 3300013104 Ga0157370_10386598 Ga0157370_103865982 227
97 3300013307 Ga0157372_10265683 Ga0157372_102656832 227
98 3300021361 Ga0213872_10073062 Ga0213872_100730622 227
99 3300031548 Ga0307408_100422392 Ga0307408_1004223922 227
100 3300032002 Ga0307416_100315534 Ga0307416_1003155342 227
101 3300032004 Ga0307414_10766883 Ga0307414_107668831 227
102 3300039447 Ga0436361_0074731 Ga0436361_0074731_3735_4418 227
103 3300039447 Ga0436361_0664887 Ga0436361_0664887_3153_3836 227
104 3300048919 Ga0496116_0219136 Ga0496116_0219136_236_919 227
105 3300049572 Ga0501036_0088455 Ga0501036_0088455_571_1254 227
106 3300049575 Ga0501039_0257414 Ga0501039_0257414_530_1213 227
107 3300049576 Ga0501040_0428752 Ga0501040_0428752_92_775 227
108 3300049577 Ga0501041_0213169 Ga0501041_0213169_257_940 227
109 3300049578 Ga0501042_0093244 Ga0501042_0093244_1018_1701 227
110 3300049587 Ga0501071_0236100 Ga0501071_0236100_456_1139 227
111 3300049592 Ga0501076_0485074 Ga0501076_0485074_50_733 227
112 3300049593 Ga0501077_0314780 Ga0501077_0314780_68_751 227
113 3300049743 Ga0501081_0339848 Ga0501081_0339848_240_923 227
114 3300049822 Ga0501035_0523772 Ga0501035_0523772_85_768 227
115 3300053125 Ga0500618_003878 Ga0500618_003878_2386_3069 227
116 3300054114 Ga0501084_0339291 Ga0501084_0339291_482_1165 227
117 3300061734 Ga0530510_0060003 Ga0530510_0060003_1406_2089 227
118 3300005614 Ga0068856_100040676 Ga0068856_1000406766 228
119 3300014497 Ga0182008_10024426 Ga0182008_100244264 228
120 3300015262 Ga0182007_10010844 Ga0182007_100108445 228
121 3300020080 Ga0206350_11609373 Ga0206350_116093731 228
122 3300025949 Ga0207667_10102461 Ga0207667_101024613 228
123 3300037471 Ga0395905_0000242 Ga0395905_0000242_20356_21045 228
124 3300042121 Ga0450919_000233 Ga0450919_000233_1079_1765 228
125 3300042531 Ga0450918_000062 Ga0450918_000062_4164_4850 228
126 3300046460 Ga0495638_0004808 Ga0495638_0004808_3283_4005 228
127 3300046519 Ga0495632_0118491 Ga0495632_0118491_152_847 228
128 3300046522 Ga0495643_0003926 Ga0495643_0003926_325_1020 228
129 3300046694 Ga0495649_0078887 Ga0495649_0078887_918_1613 228
130 3300047445 Ga0495677_0000170 Ga0495677_0000170_19719_20408 228
131 3300047445 Ga0495677_0005180 Ga0495677_0005180_3841_4536 228
132 3300048091 Ga0495626_0065199 Ga0495626_0065199_537_1232 228
133 3300048913 Ga0496110_0000519 Ga0496110_0000519_3499_4194 228
134 3300048914 Ga0496111_0164083 Ga0496111_0164083_549_1244 228
135 3300048926 Ga0496123_0022254 Ga0496123_0022254_3482_4204 228
136 3300049572 Ga0501036_0771574 Ga0501036_0771574_37_759 229
137 3300049573 Ga0501037_0140421 Ga0501037_0140421_232_954 229
138 3300049574 Ga0501038_0095256 Ga0501038_0095256_827_1549 229
139 3300049576 Ga0501040_0038514 Ga0501040_0038514_1594_2316 229
140 3300049577 Ga0501041_0021717 Ga0501041_0021717_1808_2530 229
141 3300049579 Ga0501043_0360245 Ga0501043_0360245_12_734 229
142 3300049580 Ga0501046_0039970 Ga0501046_0039970_2516_3238 229
143 3300049582 Ga0501048_0104477 Ga0501048_0104477_1085_1807 229
144 3300049586 Ga0501070_0713624 Ga0501070_0713624_41_763 229
145 3300049587 Ga0501071_0039724 Ga0501071_0039724_227_949 229
146 3300049588 Ga0501072_0356839 Ga0501072_0356839_69_791 229
147 3300049591 Ga0501075_0037095 Ga0501075_0037095_2406_3128 229
148 3300049592 Ga0501076_0017382 Ga0501076_0017382_1986_2708 229
149 3300049593 Ga0501077_0524915 Ga0501077_0524915_27_749 229
150 3300049742 Ga0501080_0008804 Ga0501080_0008804_404_1126 229
151 3300049743 Ga0501081_0109631 Ga0501081_0109631_724_1446 229
152 3300049822 Ga0501035_0680079 Ga0501035_0680079_78_800 229
153 3300054114 Ga0501084_0309410 Ga0501084_0309410_227_949 229
154 3300060353 Ga0501082_0032220 Ga0501082_0032220_16_738 229
155 3300061734 Ga0530510_0031070 Ga0530510_0031070_1230_1952 229
156 iso_pu_bacteria 2585428060 2587748374 229
157 iso_pu_bacteria 2585428060 2587748502 229
158 iso_pu_bacteria 2588253712 2588446184 229
159 3300003316 rootH1_10073884 rootH1_100738843 232
160 3300021361 Ga0213872_10035388 Ga0213872_100353882 237
161 3300031824 Ga0307413_10100640 Ga0307413_101006401 239
162 3300031852 Ga0307410_10170152 Ga0307410_101701522 239
163 3300031901 Ga0307406_10132212 Ga0307406_101322121 239
164 3300031911 Ga0307412_10420571 Ga0307412_104205712 239
165 3300031995 Ga0307409_100614649 Ga0307409_1006146492 239
166 3300032005 Ga0307411_10229148 Ga0307411_102291481 239
167 3300049668 Ga0501233_011288 Ga0501233_011288_786_1508 239
168 3300049769 Ga0501272_020227 Ga0501272_020227_14_736 239
169 3300053158 Ga0500627_0055528 Ga0500627_0055528_909_1670 239
170 3300053730 Ga0500645_071722 Ga0500645_071722_137_898 239
171 iso_pu_bacteria 2842509118 2842510672 239
172 3300047317 Ga0495604_0091551 Ga0495604_0091551_1184_1912 240
173 3300047471 Ga0495684_0175704 Ga0495684_0175704_94_822 240
174 3300049761 Ga0501264_000268 Ga0501264_000268_6714_7568 249
175 3300047472 Ga0495686_0001186 Ga0495686_0001186_8514_9293 250
176 3300031548 Ga0307408_100165398 Ga0307408_1001653982 251
177 3300049670 Ga0501236_014242 Ga0501236_014242_235_1020 251
178 3300049686 Ga0501257_003187 Ga0501257_003187_1256_2041 251
179 3300046809 Ga0495600_0022884 Ga0495600_0022884_2006_2782 253
180 3300003322 rootL2_10053297 rootL2_100532978 255
181 3300049677 Ga0501247_011431 Ga0501247_011431_95_886 262
182 3300039447 Ga0436361_0494143 Ga0436361_0494143_11534_12397 263
183 3300003316 rootH1_10033260 rootH1_1003326019 264
184 3300003320 rootH2_10180610 rootH2_101806101 264
185 3300003323 rootH1_10054477 rootH1_1005447716 264
186 3300006358 Ga0068871_100343613 Ga0068871_1003436131 264
187 3300006931 Ga0097620_100273726 Ga0097620_1002737262 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

65

269

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9622 37 260
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9456 37 260
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9338 36 264
4qyx-assembly1.cif.gz_A crystal structure of ydr533cp 0.9316 38 260
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9257 36 264
ID Description Score Start End Superfamily
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9673 37 258 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9619 37 260 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9588 37 258 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9453 37 260 3.40.50.880
af_Q04902_1_237_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9344 37 261 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A349P5K1-F1-model_v4 deleted 1.004 131 260
AF-A0A530C1L7-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 1.003 183 262 GO:0016740
AF-S9QIH0-F1-model_v4 ThiJ/PfpI family protein 1.002 186 264
AF-A0A355QWN9-F1-model_v4 deleted 1.001 138 263
AF-W4RWS6-F1-model_v4 ThiJ/PfpI family protein 1.001 143 261 GO:0005737
GO:0019172
GO:0019243

Feature Viewer

pLDDT pTM Quality
90.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map