F288288

General Info

Members Datasets Scaffolds Average Seq Length
187 131 186 320

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0055842|Ga0496114_0055842_263_1288
Length 341
Sequence VIGARPFFASGPLGIRLSAQSMRVLVTGAAGFIGSHLSERLLARGDEVVGLDNFDPFYPRAVKEQNLAGLRKSPRFSLVEGDLRAPADLERAFGAGRFDAVVHLAALAGVQPSLADPARYADVNVLGTVRVTEAARANGVKRIVFASSSSVYGRDSRPPFKEADPCLQPVSPYASTKRAGELGLFTAHHLYGLDVTCLRFFTVYGPRQRPDLAIHKFARLILAGKPISLFGDGSTSRDYTWIDDIIDGVVAALDETGRGAPAFRIYNLGGSRTTTLLRLVELLSEALGKKPVIEWKPEQPGDMKHTHADVSHVGKALGYAPRVPIEEGIARFAAWVKAQPR

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.56
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10354898 3300003322 Bacteria 1321
2 Ga0065707_10094702 3300005295 Bacteria 3463
3 Ga0070676_10004959 3300005328 Bacteria 7047
4 Ga0070683_100002687 3300005329 Bacteria 14214
5 Ga0070683_100041104 3300005329 Bacteria 4251
6 Ga0070690_100001765 3300005330 Bacteria 11441
7 Ga0070690_100008402 3300005330 Bacteria 5944
8 Ga0070670_100012568 3300005331 Bacteria 7248
9 Ga0070689_100020446 3300005340 Bacteria 4912
10 Ga0070687_100014106 3300005343 Bacteria 3582
11 Ga0070687_100082557 3300005343 Bacteria 1757
12 Ga0070692_10103792 3300005345 Bacteria 1562
13 Ga0070668_100004900 3300005347 Bacteria 9921
14 Ga0070669_100003694 3300005353 Bacteria 11040
15 Ga0070671_100204455 3300005355 Bacteria 1675
16 Ga0070674_100004885 3300005356 Bacteria 7680
17 Ga0070673_100008672 3300005364 Bacteria 6775
18 Ga0070688_100010861 3300005365 Bacteria 5038
19 Ga0070688_100026241 3300005365 Bacteria 3459
20 Ga0068867_100091384 3300005459 Bacteria 2311
21 Ga0070698_100409838 3300005471 Unclassified 1289
22 Ga0070699_100000001 3300005518 Bacteria 910751
23 Ga0070679_100017362 3300005530 Bacteria 6965
24 Ga0070679_100019094 3300005530 Bacteria 6660
25 Ga0070684_100043304 3300005535 Bacteria 3887
26 Ga0070684_100142074 3300005535 Bacteria 2171
27 Ga0070672_100013223 3300005543 Bacteria 5822
28 Ga0070672_100031197 3300005543 Bacteria 4010
29 Ga0070672_100032324 3300005543 Bacteria 3948
30 Ga0070686_100033459 3300005544 Bacteria 3159
31 Ga0070696_100023556 3300005546 Bacteria 4185
32 Ga0070696_100420410 3300005546 Bacteria 1049
33 Ga0070704_100271712 3300005549 Bacteria 1401
34 Ga0070664_100050740 3300005564 Bacteria 3512
35 Ga0068857_100045838 3300005577 Bacteria 3880
36 Ga0068856_100143353 3300005614 Bacteria 2397
37 Ga0068861_100216688 3300005719 Bacteria 1615
38 Ga0068863_100066725 3300005841 Bacteria 3403
39 Ga0068860_100026613 3300005843 Bacteria 5576
40 Ga0070717_10082184 3300006028 Bacteria 2706
41 Ga0097621_100333943 3300006237 Bacteria 1345
42 Ga0075433_10002743 3300006852 Bacteria 13465
43 Ga0075434_100012050 3300006871 Bacteria 8184
44 Ga0075429_100017928 3300006880 Bacteria 6121
45 Ga0068865_100001118 3300006881 Bacteria 15498
46 Ga0105240_10111521 3300009093 Bacteria 3309
47 Ga0157378_10146074 3300013297 Bacteria 2200
48 Ga0157378_10146227 3300013297 Bacteria 2199
49 Ga0157372_10159651 3300013307 Bacteria 2605
50 Ga0157379_10084932 3300014968 Bacteria 2836
51 Ga0207653_10022703 3300025885 Bacteria 1994
52 Ga0207645_10003675 3300025907 Bacteria 11569
53 Ga0207662_10021064 3300025918 Bacteria 3721
54 Ga0207662_10059868 3300025918 Bacteria 2283
55 Ga0207652_10018604 3300025921 Bacteria 5700
56 Ga0207681_10001893 3300025923 Bacteria 13387
57 Ga0207650_10013906 3300025925 Bacteria 5582
58 Ga0207644_10204321 3300025931 Bacteria 1559
59 Ga0207670_10021141 3300025936 Bacteria 4009
60 Ga0207669_10000256 3300025937 Bacteria 24352
61 Ga0207704_10001533 3300025938 Bacteria 10352
62 Ga0207691_10018013 3300025940 Bacteria 6686
63 Ga0207691_10020308 3300025940 Bacteria 6281
64 Ga0207691_10066145 3300025940 Bacteria 3271
65 Ga0207661_10006034 3300025944 Bacteria 8563
66 Ga0207661_10082726 3300025944 Bacteria 2655
67 Ga0207651_10066547 3300025960 Bacteria 2532
68 Ga0207668_10016213 3300025972 Bacteria 4645
69 Ga0207708_10020526 3300026075 Bacteria 4983
70 Ga0207702_10096022 3300026078 Bacteria 2606
71 Ga0207648_10054657 3300026089 Bacteria 3487
72 Ga0207675_100396578 3300026118 Bacteria 1359
73 Ga0207683_10049773 3300026121 Bacteria 3669
74 Ga0207428_10010062 3300027907 Bacteria 8466
75 Ga0207428_10012757 3300027907 Bacteria 7369
76 Ga0268264_10017430 3300028381 Bacteria 5881
77 Ga0265338_10006821 3300028800 Bacteria 14388
78 Ga0265332_10021968 3300031238 Bacteria 2817
79 Ga0265328_10002314 3300031239 Bacteria 8588
80 Ga0265320_10006639 3300031240 Bacteria 7270
81 Ga0265320_10020047 3300031240 Bacteria 3636
82 Ga0265340_10012692 3300031247 Bacteria 4446
83 Ga0265340_10059006 3300031247 Bacteria 1841
84 Ga0265339_10028859 3300031249 Bacteria 3152
85 Ga0265339_10038061 3300031249 Bacteria 2685
86 Ga0265314_10020086 3300031711 Bacteria 5160
87 Ga0265314_10081919 3300031711 Bacteria 2124
88 Ga0265342_10000456 3300031712 Bacteria 44706
89 Ga0265342_10002060 3300031712 Bacteria 17851
90 Ga0316577_10007623 3300031733 Bacteria 5774
91 Ga0373950_0000003 3300034818 Bacteria 541085
92 Ga0373950_0000012 3300034818 Bacteria 352408
93 Ga0373954_0020299 3300035118 Bacteria 3004
94 Ga0373956_0025838 3300035119 Bacteria 2540
95 Ga0373957_0006869 3300035120 Bacteria 3610
96 Ga0373957_0023866 3300035120 Bacteria 2191
97 Ga0373946_0031938 3300035171 Bacteria 2112
98 Ga0373955_0003250 3300035172 Bacteria 7122
99 Ga0373924_0051049 3300035410 Bacteria 1714
100 Ga0373927_0084821 3300035695 Bacteria 2055
101 Ga0373933_0004597 3300035724 Bacteria 7556
102 Ga0373933_0214994 3300035724 Bacteria 1232
103 Ga0373937_0000247 3300036401 Bacteria 52788
104 Ga0373937_0001396 3300036401 Bacteria 20159
105 Ga0373937_0122079 3300036401 Bacteria 2428
106 Ga0373937_0161717 3300036401 Bacteria 2099
107 Ga0373937_0162477 3300036401 Bacteria 2094
108 Ga0316584_0000101 3300036712 Bacteria 35219
109 Ga0373925_0011374 3300037068 Bacteria 6455
110 Ga0373925_0032384 3300037068 Bacteria 3848
111 Ga0373925_0109061 3300037068 Bacteria 2137
112 Ga0466961_0122821 3300044693 Bacteria 1630
113 Ga0453684_0000036 3300044712 Bacteria 711481
114 Ga0453684_0098025 3300044712 Bacteria 3595
115 Ga0453684_0210731 3300044712 Bacteria 2259
116 Ga0453684_0230399 3300044712 Bacteria 2139
117 Ga0451576_0148063 3300045051 Bacteria 2448
118 Ga0495641_0034912 3300046461 Bacteria 2374
119 Ga0495651_0199617 3300046462 Bacteria 1401
120 Ga0495630_0088836 3300046517 Bacteria 2334
121 Ga0495586_0042266 3300046535 Bacteria 2455
122 Ga0495634_0005776 3300046642 Bacteria 9451
123 Ga0495599_0110897 3300046678 Bacteria 1709
124 Ga0495613_0108898 3300046689 Bacteria 1998
125 Ga0495674_0057413 3300047319 Bacteria 3406
126 Ga0495602_0190083 3300048088 Bacteria 1575
127 Ga0496100_0040715 3300048903 Bacteria 2958
128 Ga0496101_0012187 3300048904 Bacteria 5731
129 Ga0496104_0287472 3300048907 Bacteria 1557
130 Ga0496105_0410606 3300048908 Bacteria 1073
131 Ga0496107_0129559 3300048910 Bacteria 1862
132 Ga0496108_0017338 3300048911 Bacteria 5890
133 Ga0496109_0063623 3300048912 Bacteria 3375
134 Ga0496110_0230860 3300048913 Bacteria 1683
135 Ga0496112_0348984 3300048915 Bacteria 1422
136 Ga0496114_0000467 3300048917 Bacteria 29551
137 Ga0496114_0029061 3300048917 Bacteria 4541
138 Ga0496114_0055842 3300048917 Bacteria 3294
139 Ga0496114_0376164 3300048917 Bacteria 1257
140 Ga0496115_0072254 3300048918 Bacteria 2799
141 Ga0496115_0108360 3300048918 Bacteria 2281
142 Ga0496115_0389692 3300048918 Bacteria 1132
143 Ga0501034_0002628 3300049571 Bacteria 21312
144 Ga0501043_0003970 3300049579 Bacteria 12116
145 Ga0501046_0000401 3300049580 Bacteria 43364
146 Ga0501047_0000467 3300049581 Bacteria 44231
147 Ga0501048_0001194 3300049582 Bacteria 19661
148 Ga0501067_0000113 3300049583 Bacteria 45342
149 Ga0501067_0037425 3300049583 Bacteria 2695
150 Ga0501068_0052423 3300049584 Bacteria 2468
151 Ga0501068_0054335 3300049584 Bacteria 2426
152 Ga0501070_0000072 3300049586 Bacteria 86624
153 Ga0501070_0001874 3300049586 Bacteria 18578
154 Ga0501070_0125743 3300049586 Bacteria 2119
155 Ga0501072_0000455 3300049588 Bacteria 29533
156 Ga0501073_0000113 3300049589 Bacteria 52093
157 Ga0501073_0004089 3300049589 Bacteria 10943
158 Ga0501073_0016057 3300049589 Bacteria 5428
159 Ga0501073_0029115 3300049589 Bacteria 3946
160 Ga0501073_0032987 3300049589 Bacteria 3690
161 Ga0501073_0163178 3300049589 Bacteria 1543
162 Ga0501074_0082066 3300049590 Bacteria 2312
163 Ga0501074_0100389 3300049590 Bacteria 2071
164 Ga0501076_0121086 3300049592 Bacteria 2119
165 Ga0501077_0265418 3300049593 Bacteria 1092
166 Ga0501079_0004241 3300049741 Bacteria 10630
167 Ga0501079_0121998 3300049741 Bacteria 2027
168 Ga0501080_0000526 3300049742 Bacteria 30055
169 Ga0501080_0017849 3300049742 Bacteria 6567
170 Ga0501080_0022170 3300049742 Bacteria 5883
171 Ga0501083_0000975 3300049744 Bacteria 18976
172 Ga0501083_0019488 3300049744 Bacteria 4726
173 Ga0501044_0083156 3300049823 Bacteria 3238
174 Ga0501044_0289130 3300049823 Bacteria 1571
175 nmdc:mga09592_244564_c1 3300050508 Bacteria 1555
176 nmdc:mga08y16_42638_c1 3300050511 Bacteria 4752
177 nmdc:mga08y16_728691_c1 3300050511 Bacteria 989
178 nmdc:mga0n895_31404_c1 3300050512 Bacteria 3805
179 nmdc:mga0a205_178301_c1 3300050515 Bacteria 2020
180 Ga0495601_0044747 3300053077 Bacteria 2783
181 Ga0495619_0021368 3300053085 Bacteria 4131
182 Ga0501084_0000223 3300054114 Bacteria 43414
183 Ga0501084_0168115 3300054114 Bacteria 1851
184 Ga0501082_0001369 3300060353 Bacteria 21441
185 Ga0501082_0014432 3300060353 Bacteria 6798
186 Ga0501082_0208393 3300060353 Bacteria 1701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_728691_c1 nmdc:mga08y16_728691_c1_108_965 282
2 3300049741 Ga0501079_0121998 Ga0501079_0121998_1117_1992 289
3 3300044712 Ga0453684_0230399 Ga0453684_0230399_261_1247 304
4 3300036401 Ga0373937_0161717 Ga0373937_0161717_581_1543 306
5 3300005549 Ga0070704_100271712 Ga0070704_1002717121 308
6 3300027907 Ga0207428_10010062 Ga0207428_100100628 308
7 3300050511 nmdc:mga08y16_42638_c1 nmdc:mga08y16_42638_c1_1107_2072 308
8 3300025885 Ga0207653_10022703 Ga0207653_100227033 309
9 3300005343 Ga0070687_100014106 Ga0070687_1000141062 313
10 3300046689 Ga0495613_0108898 Ga0495613_0108898_647_1594 313
11 3300005329 Ga0070683_100041104 Ga0070683_1000411044 314
12 3300005530 Ga0070679_100017362 Ga0070679_1000173628 314
13 3300005530 Ga0070679_100019094 Ga0070679_1000190942 314
14 3300013307 Ga0157372_10159651 Ga0157372_101596512 314
15 3300014968 Ga0157379_10084932 Ga0157379_100849321 314
16 3300025921 Ga0207652_10018604 Ga0207652_100186046 314
17 3300031247 Ga0265340_10012692 Ga0265340_100126922 314
18 3300031247 Ga0265340_10059006 Ga0265340_100590062 314
19 3300031733 Ga0316577_10007623 Ga0316577_100076233 314
20 3300036401 Ga0373937_0162477 Ga0373937_0162477_455_1414 314
21 3300036712 Ga0316584_0000101 Ga0316584_0000101_19938_20885 314
22 3300044712 Ga0453684_0098025 Ga0453684_0098025_1004_1954 314
23 3300048088 Ga0495602_0190083 Ga0495602_0190083_604_1557 314
24 3300048908 Ga0496105_0410606 Ga0496105_0410606_20_970 314
25 3300048918 Ga0496115_0108360 Ga0496115_0108360_1269_2219 314
26 3300005577 Ga0068857_100045838 Ga0068857_1000458385 315
27 iso_pu_bacteria 2739367866 2740032868 315
28 3300005295 Ga0065707_10094702 Ga0065707_100947022 316
29 3300005471 Ga0070698_100409838 Ga0070698_1004098381 316
30 3300005518 Ga0070699_100000001 Ga0070699_100000001750 316
31 3300006852 Ga0075433_10002743 Ga0075433_100027439 316
32 3300006871 Ga0075434_100012050 Ga0075434_1000120502 316
33 3300031249 Ga0265339_10028859 Ga0265339_100288593 316
34 3300036401 Ga0373937_0122079 Ga0373937_0122079_1099_2058 316
35 3300044693 Ga0466961_0122821 Ga0466961_0122821_421_1377 316
36 3300044712 Ga0453684_0210731 Ga0453684_0210731_323_1279 316
37 3300048917 Ga0496114_0029061 Ga0496114_0029061_1575_2531 316
38 3300048917 Ga0496114_0376164 Ga0496114_0376164_76_1032 316
39 3300048918 Ga0496115_0389692 Ga0496115_0389692_87_1043 316
40 3300049584 Ga0501068_0054335 Ga0501068_0054335_998_1954 316
41 3300049586 Ga0501070_0000072 Ga0501070_0000072_36273_37229 316
42 3300049586 Ga0501070_0125743 Ga0501070_0125743_1078_2034 316
43 3300049589 Ga0501073_0029115 Ga0501073_0029115_1191_2147 316
44 3300049589 Ga0501073_0163178 Ga0501073_0163178_406_1362 316
45 3300049742 Ga0501080_0017849 Ga0501080_0017849_75_1031 316
46 3300049744 Ga0501083_0019488 Ga0501083_0019488_1138_2094 316
47 3300050512 nmdc:mga0n895_31404_c1 nmdc:mga0n895_31404_c1_1983_2939 316
48 3300050515 nmdc:mga0a205_178301_c1 nmdc:mga0a205_178301_c1_446_1402 316
49 3300060353 Ga0501082_0014432 Ga0501082_0014432_917_1873 316
50 3300005328 Ga0070676_10004959 Ga0070676_100049593 317
51 3300005329 Ga0070683_100002687 Ga0070683_1000026874 317
52 3300005330 Ga0070690_100008402 Ga0070690_1000084025 317
53 3300005340 Ga0070689_100020446 Ga0070689_1000204464 317
54 3300005343 Ga0070687_100082557 Ga0070687_1000825572 317
55 3300005345 Ga0070692_10103792 Ga0070692_101037921 317
56 3300005347 Ga0070668_100004900 Ga0070668_1000049006 317
57 3300005353 Ga0070669_100003694 Ga0070669_1000036944 317
58 3300005355 Ga0070671_100204455 Ga0070671_1002044552 317
59 3300005356 Ga0070674_100004885 Ga0070674_1000048853 317
60 3300005364 Ga0070673_100008672 Ga0070673_1000086722 317
61 3300005365 Ga0070688_100010861 Ga0070688_1000108614 317
62 3300005365 Ga0070688_100026241 Ga0070688_1000262413 317
63 3300005459 Ga0068867_100091384 Ga0068867_1000913841 317
64 3300005535 Ga0070684_100043304 Ga0070684_1000433043 317
65 3300005535 Ga0070684_100142074 Ga0070684_1001420741 317
66 3300005543 Ga0070672_100013223 Ga0070672_1000132234 317
67 3300005543 Ga0070672_100032324 Ga0070672_1000323242 317
68 3300005546 Ga0070696_100023556 Ga0070696_1000235563 317
69 3300005546 Ga0070696_100420410 Ga0070696_1004204101 317
70 3300005614 Ga0068856_100143353 Ga0068856_1001433532 317
71 3300005719 Ga0068861_100216688 Ga0068861_1002166882 317
72 3300006028 Ga0070717_10082184 Ga0070717_100821842 317
73 3300006237 Ga0097621_100333943 Ga0097621_1003339432 317
74 3300006880 Ga0075429_100017928 Ga0075429_1000179282 317
75 3300006881 Ga0068865_100001118 Ga0068865_10000111811 317
76 3300009093 Ga0105240_10111521 Ga0105240_101115212 317
77 3300013297 Ga0157378_10146074 Ga0157378_101460742 317
78 3300025907 Ga0207645_10003675 Ga0207645_100036753 317
79 3300025918 Ga0207662_10059868 Ga0207662_100598682 317
80 3300025923 Ga0207681_10001893 Ga0207681_1000189312 317
81 3300025931 Ga0207644_10204321 Ga0207644_102043212 317
82 3300025936 Ga0207670_10021141 Ga0207670_100211414 317
83 3300025937 Ga0207669_10000256 Ga0207669_1000025614 317
84 3300025938 Ga0207704_10001533 Ga0207704_100015336 317
85 3300025940 Ga0207691_10018013 Ga0207691_100180133 317
86 3300025940 Ga0207691_10020308 Ga0207691_100203083 317
87 3300025944 Ga0207661_10006034 Ga0207661_100060345 317
88 3300025944 Ga0207661_10082726 Ga0207661_100827262 317
89 3300025972 Ga0207668_10016213 Ga0207668_100162133 317
90 3300026075 Ga0207708_10020526 Ga0207708_100205262 317
91 3300026078 Ga0207702_10096022 Ga0207702_100960223 317
92 3300026089 Ga0207648_10054657 Ga0207648_100546574 317
93 3300026118 Ga0207675_100396578 Ga0207675_1003965782 317
94 3300026121 Ga0207683_10049773 Ga0207683_100497734 317
95 3300027907 Ga0207428_10012757 Ga0207428_100127575 317
96 3300028800 Ga0265338_10006821 Ga0265338_100068212 317
97 3300031238 Ga0265332_10021968 Ga0265332_100219682 317
98 3300031239 Ga0265328_10002314 Ga0265328_100023142 317
99 3300031240 Ga0265320_10006639 Ga0265320_100066396 317
100 3300031240 Ga0265320_10020047 Ga0265320_100200473 317
101 3300031249 Ga0265339_10038061 Ga0265339_100380612 317
102 3300031711 Ga0265314_10020086 Ga0265314_100200864 317
103 3300031711 Ga0265314_10081919 Ga0265314_100819192 317
104 3300031712 Ga0265342_10000456 Ga0265342_1000045621 317
105 3300031712 Ga0265342_10002060 Ga0265342_100020602 317
106 3300034818 Ga0373950_0000003 Ga0373950_0000003_294984_295940 317
107 3300035120 Ga0373957_0006869 Ga0373957_0006869_620_1582 317
108 3300035120 Ga0373957_0023866 Ga0373957_0023866_1044_2006 317
109 3300036401 Ga0373937_0001396 Ga0373937_0001396_13521_14483 317
110 3300037068 Ga0373925_0109061 Ga0373925_0109061_99_1061 317
111 3300046517 Ga0495630_0088836 Ga0495630_0088836_1012_1971 317
112 3300046535 Ga0495586_0042266 Ga0495586_0042266_849_1808 317
113 3300046642 Ga0495634_0005776 Ga0495634_0005776_8353_9312 317
114 3300046678 Ga0495599_0110897 Ga0495599_0110897_585_1544 317
115 3300047319 Ga0495674_0057413 Ga0495674_0057413_1089_2048 317
116 3300048903 Ga0496100_0040715 Ga0496100_0040715_619_1590 317
117 3300048904 Ga0496101_0012187 Ga0496101_0012187_4573_5544 317
118 3300048907 Ga0496104_0287472 Ga0496104_0287472_538_1497 317
119 3300048910 Ga0496107_0129559 Ga0496107_0129559_499_1470 317
120 3300048917 Ga0496114_0000467 Ga0496114_0000467_2957_3928 317
121 3300048918 Ga0496115_0072254 Ga0496115_0072254_1082_2053 317
122 3300049583 Ga0501067_0000113 Ga0501067_0000113_39810_40766 317
123 3300049583 Ga0501067_0037425 Ga0501067_0037425_1212_2171 317
124 3300049589 Ga0501073_0000113 Ga0501073_0000113_40190_41149 317
125 3300049589 Ga0501073_0004089 Ga0501073_0004089_3333_4292 317
126 3300049589 Ga0501073_0016057 Ga0501073_0016057_2935_3891 317
127 3300049589 Ga0501073_0032987 Ga0501073_0032987_473_1432 317
128 3300049590 Ga0501074_0082066 Ga0501074_0082066_1168_2127 317
129 3300049742 Ga0501080_0022170 Ga0501080_0022170_779_1735 317
130 3300049823 Ga0501044_0289130 Ga0501044_0289130_172_1140 317
131 3300050508 nmdc:mga09592_244564_c1 nmdc:mga09592_244564_c1_574_1542 317
132 3300053077 Ga0495601_0044747 Ga0495601_0044747_214_1173 317
133 3300060353 Ga0501082_0208393 Ga0501082_0208393_51_1010 317
134 3300034818 Ga0373950_0000012 Ga0373950_0000012_59884_60846 318
135 3300035118 Ga0373954_0020299 Ga0373954_0020299_1821_2783 318
136 3300035119 Ga0373956_0025838 Ga0373956_0025838_158_1120 318
137 3300035724 Ga0373933_0214994 Ga0373933_0214994_227_1189 318
138 3300036401 Ga0373937_0000247 Ga0373937_0000247_16755_17717 318
139 3300044712 Ga0453684_0000036 Ga0453684_0000036_569067_570044 318
140 3300046462 Ga0495651_0199617 Ga0495651_0199617_18_980 318
141 3300048911 Ga0496108_0017338 Ga0496108_0017338_4094_5116 318
142 3300048912 Ga0496109_0063623 Ga0496109_0063623_1543_2565 318
143 3300048913 Ga0496110_0230860 Ga0496110_0230860_359_1381 318
144 3300049571 Ga0501034_0002628 Ga0501034_0002628_19388_20350 318
145 3300049579 Ga0501043_0003970 Ga0501043_0003970_2868_3830 318
146 3300049580 Ga0501046_0000401 Ga0501046_0000401_24248_25210 318
147 3300049581 Ga0501047_0000467 Ga0501047_0000467_19021_19983 318
148 3300049582 Ga0501048_0001194 Ga0501048_0001194_17997_18959 318
149 3300049584 Ga0501068_0052423 Ga0501068_0052423_1042_2004 318
150 3300049586 Ga0501070_0001874 Ga0501070_0001874_15703_16665 318
151 3300049588 Ga0501072_0000455 Ga0501072_0000455_18102_19064 318
152 3300049590 Ga0501074_0100389 Ga0501074_0100389_1039_2001 318
153 3300049741 Ga0501079_0004241 Ga0501079_0004241_5836_6798 318
154 3300049742 Ga0501080_0000526 Ga0501080_0000526_24249_25211 318
155 3300049744 Ga0501083_0000975 Ga0501083_0000975_963_1925 318
156 3300049823 Ga0501044_0083156 Ga0501044_0083156_1570_2532 318
157 3300053085 Ga0495619_0021368 Ga0495619_0021368_427_1389 318
158 3300054114 Ga0501084_0000223 Ga0501084_0000223_24241_25203 318
159 3300060353 Ga0501082_0001369 Ga0501082_0001369_17977_18939 318
160 3300005330 Ga0070690_100001765 Ga0070690_1000017658 319
161 3300005331 Ga0070670_100012568 Ga0070670_1000125685 319
162 3300005543 Ga0070672_100031197 Ga0070672_1000311972 319
163 3300005544 Ga0070686_100033459 Ga0070686_1000334591 319
164 3300005841 Ga0068863_100066725 Ga0068863_1000667253 319
165 3300013297 Ga0157378_10146227 Ga0157378_101462272 319
166 3300025918 Ga0207662_10021064 Ga0207662_100210642 319
167 3300025925 Ga0207650_10013906 Ga0207650_100139062 319
168 3300025940 Ga0207691_10066145 Ga0207691_100661452 319
169 3300025960 Ga0207651_10066547 Ga0207651_100665472 319
170 3300035695 Ga0373927_0084821 Ga0373927_0084821_1068_2033 319
171 3300035724 Ga0373933_0004597 Ga0373933_0004597_4463_5437 319
172 3300037068 Ga0373925_0032384 Ga0373925_0032384_1204_2169 319
173 3300045051 Ga0451576_0148063 Ga0451576_0148063_394_1359 319
174 3300048915 Ga0496112_0348984 Ga0496112_0348984_386_1351 319
175 3300048917 Ga0496114_0055842 Ga0496114_0055842_263_1288 319
176 3300049593 Ga0501077_0265418 Ga0501077_0265418_71_1036 319
177 3300054114 Ga0501084_0168115 Ga0501084_0168115_584_1549 319
178 3300049592 Ga0501076_0121086 Ga0501076_0121086_260_1222 320
179 3300005564 Ga0070664_100050740 Ga0070664_1000507404 321
180 3300035171 Ga0373946_0031938 Ga0373946_0031938_283_1257 321
181 3300035172 Ga0373955_0003250 Ga0373955_0003250_3938_4921 321
182 3300035410 Ga0373924_0051049 Ga0373924_0051049_506_1489 321
183 3300037068 Ga0373925_0011374 Ga0373925_0011374_2055_3038 321
184 3300046461 Ga0495641_0034912 Ga0495641_0034912_70_1044 321
185 3300003322 rootL2_10354898 rootL2_103548982 322
186 3300005843 Ga0068860_100026613 Ga0068860_1000266132 322
187 3300028381 Ga0268264_10017430 Ga0268264_100174302 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

269

0.95

PF04321

RmlD_sub_bind

RmlD substrate binding domain

22

308

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

25

332

0.88

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

25

258

0.81

PF07993

NAD_binding_4

Male sterility protein

26

225

0.78

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

24

291

0.76

PF13460

NAD_binding_10

NAD(P)H-binding

28

209

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zlj-assembly1.cif.gz_B-2 crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad 0.9464 2 318
6zlj-assembly1.cif.gz_B-2 crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad 0.9434 2 318
6zlk-assembly2.cif.gz_B equilibrium structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid/udp-galacturonic acid and nad 0.9356 2 318
3ko8-assembly1.cif.gz_A-2 crystal structure of udp-galactose 4-epimerase 0.9331 2 317
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9329 3 317
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.971 2 33 3.50.50.60
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9674 2 33 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9613 1 33 3.50.50.60
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9564 2 33 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9525 2 33 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C5I342-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9863 102 319
AF-A0A2E1CKI4-F1-model_v4 deleted 0.973 2 315
AF-A0A7W1W9D8-F1-model_v4 GDP-mannose 4,6-dehydratase 0.9692 164 321
AF-A0A2V5LUD6-F1-model_v4 Epimerase 0.9679 182 318
AF-A0A7V2IR48-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9675 2 204

Feature Viewer

pLDDT pTM Quality
94.99 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map