F288125

General Info

Members Datasets Scaffolds Average Seq Length
187 46 187 143

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_1265498|Ga0453684_1265498_124_600
Length 158
Sequence MLGCFTTESNSKEKAMKVEQISIFIENKSGRLAEVADILGRSGINIRALSLADTSDFGILRLIVNDSGKAKQVLKDKGFTVGKTEVVAVEVPDRPGGLSQILTALDEESINVEYMYAFVERCGENAVIIFRFDETEKAIKALLDRGFNILEGARLYQM

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
4 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
5 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
6 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
7 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
8 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
9 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
10 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
11 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
12 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
13 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
14 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
15 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
16 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
17 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
18 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
19 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
21 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
22 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
23 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
24 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
25 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
26 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
27 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
28 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
29 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
30 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
31 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
32 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
33 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
34 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
35 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
36 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
37 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
38 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
39 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
40 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
41 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
42 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
43 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
45 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
46 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.4
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10088852 3300005289 Bacteria 2873
2 Ga0065707_10101177 3300005295 Bacteria 2880
3 Ga0265318_10017436 3300028577 Bacteria 2948
4 Ga0265323_10003700 3300028653 Bacteria 6696
5 Ga0265322_10002327 3300028654 Bacteria 5880
6 Ga0265330_10011716 3300031235 Bacteria 4108
7 Ga0265330_10173103 3300031235 Bacteria 915
8 Ga0265328_10044571 3300031239 Bacteria 1631
9 Ga0265320_10454146 3300031240 Unclassified 566
10 Ga0265329_10004147 3300031242 Bacteria 6115
11 Ga0265339_10008935 3300031249 Bacteria 6338
12 Ga0265331_10045000 3300031250 Bacteria 2132
13 Ga0265331_10193504 3300031250 Unclassified 917
14 Ga0265327_10015465 3300031251 Bacteria 4922
15 Ga0265327_10280983 3300031251 Unclassified 736
16 Ga0265316_10000285 3300031344 Bacteria 56873
17 Ga0265316_10063458 3300031344 Bacteria 2864
18 Ga0265316_10092515 3300031344 Bacteria 2305
19 Ga0265314_10008324 3300031711 Bacteria 8892
20 Ga0265342_10000980 3300031712 Bacteria 28257
21 Ga0316576_11026577 3300031727 Bacteria 587
22 Ga0316576_11051809 3300031727 Bacteria 579
23 Ga0316578_10418099 3300031728 Bacteria 794
24 Ga0316577_10047867 3300031733 Bacteria 2388
25 Ga0316577_10460155 3300031733 Bacteria 723
26 Ga0316592_1160094 3300033524 Unclassified 533
27 Ga0373928_0001117 3300035084 Bacteria 5310
28 Ga0316574_0002992 3300035398 Bacteria 8614
29 Ga0316574_0324368 3300035398 Bacteria 977
30 Ga0373937_0065819 3300036401 Bacteria 3337
31 Ga0316582_0512949 3300036647 Unclassified 826
32 Ga0316582_0845436 3300036647 Unclassified 627
33 Ga0316584_0078626 3300036712 Bacteria 2471
34 Ga0316584_1025155 3300036712 Unclassified 550
35 Ga0316584_1121945 3300036712 Unclassified 521
36 Ga0400488_44441 3300038741 Bacteria 1948
37 Ga0400488_56113 3300038741 Bacteria 5284
38 Ga0400483_231506 3300039062 Bacteria 1375
39 Ga0451577_0000041 3300042876 Bacteria 335318
40 Ga0451577_0000065 3300042876 Bacteria 260821
41 Ga0451577_0000158 3300042876 Bacteria 151857
42 Ga0451577_0000838 3300042876 Bacteria 45984
43 Ga0451577_0003601 3300042876 Bacteria 17033
44 Ga0451577_0007106 3300042876 Bacteria 11037
45 Ga0451577_0015594 3300042876 Bacteria 7062
46 Ga0451577_0044638 3300042876 Bacteria 3968
47 Ga0451577_0054572 3300042876 Bacteria 3567
48 Ga0451577_0058800 3300042876 Bacteria 3427
49 Ga0451577_0067892 3300042876 Bacteria 3180
50 Ga0451577_0081991 3300042876 Bacteria 2877
51 Ga0451577_0101205 3300042876 Unclassified 2575
52 Ga0451577_0106682 3300042876 Bacteria 2504
53 Ga0451577_0128874 3300042876 Bacteria 2269
54 Ga0451577_0145692 3300042876 Bacteria 2129
55 Ga0451577_0162923 3300042876 Unclassified 2009
56 Ga0451577_0176340 3300042876 Bacteria 1927
57 Ga0451577_0226661 3300042876 Bacteria 1690
58 Ga0451577_0333542 3300042876 Bacteria 1375
59 Ga0451577_0348507 3300042876 Bacteria 1343
60 Ga0451577_0509559 3300042876 Bacteria 1092
61 Ga0451577_0547556 3300042876 Unclassified 1050
62 Ga0451577_0797609 3300042876 Bacteria 853
63 Ga0451577_0934106 3300042876 Bacteria 780
64 Ga0451577_0973815 3300042876 Bacteria 762
65 Ga0451577_0984111 3300042876 Bacteria 758
66 Ga0453683_0000036 3300044673 Bacteria 232009
67 Ga0453683_0000081 3300044673 Bacteria 144825
68 Ga0453683_0000108 3300044673 Bacteria 124178
69 Ga0453683_0000193 3300044673 Bacteria 84520
70 Ga0453683_0000201 3300044673 Bacteria 81122
71 Ga0453683_0000260 3300044673 Bacteria 69441
72 Ga0453683_0002096 3300044673 Bacteria 15929
73 Ga0453683_0003816 3300044673 Bacteria 10968
74 Ga0453683_0014067 3300044673 Bacteria 5206
75 Ga0453683_0014364 3300044673 Bacteria 5144
76 Ga0453683_0014960 3300044673 Bacteria 5035
77 Ga0453683_0018977 3300044673 Bacteria 4411
78 Ga0453683_0029620 3300044673 Bacteria 3461
79 Ga0453683_0033463 3300044673 Bacteria 3241
80 Ga0453683_0073292 3300044673 Bacteria 2143
81 Ga0453683_0115872 3300044673 Bacteria 1686
82 Ga0453683_0122568 3300044673 Bacteria 1637
83 Ga0453683_0129372 3300044673 Bacteria 1590
84 Ga0453683_0264815 3300044673 Bacteria 1097
85 Ga0453683_0445949 3300044673 Bacteria 837
86 Ga0453683_0575991 3300044673 Bacteria 733
87 Ga0453683_0805860 3300044673 Bacteria 618
88 Ga0453683_1082921 3300044673 Bacteria 534
89 Ga0453683_1126754 3300044673 Bacteria 524
90 Ga0453684_0000066 3300044712 Bacteria 465545
91 Ga0453684_0000089 3300044712 Bacteria 395064
92 Ga0453684_0000184 3300044712 Bacteria 274619
93 Ga0453684_0000209 3300044712 Bacteria 255543
94 Ga0453684_0000349 3300044712 Bacteria 192484
95 Ga0453684_0000743 3300044712 Bacteria 113711
96 Ga0453684_0000883 3300044712 Bacteria 100160
97 Ga0453684_0001085 3300044712 Bacteria 86493
98 Ga0453684_0001242 3300044712 Bacteria 77619
99 Ga0453684_0001947 3300044712 Bacteria 53259
100 Ga0453684_0002925 3300044712 Bacteria 40026
101 Ga0453684_0003125 3300044712 Bacteria 38148
102 Ga0453684_0004031 3300044712 Bacteria 31936
103 Ga0453684_0004714 3300044712 Bacteria 28208
104 Ga0453684_0005544 3300044712 Bacteria 24909
105 Ga0453684_0013641 3300044712 Bacteria 13164
106 Ga0453684_0019613 3300044712 Bacteria 10276
107 Ga0453684_0021476 3300044712 Bacteria 9644
108 Ga0453684_0026044 3300044712 Bacteria 8466
109 Ga0453684_0026732 3300044712 Bacteria 8317
110 Ga0453684_0030939 3300044712 Bacteria 7543
111 Ga0453684_0031388 3300044712 Bacteria 7469
112 Ga0453684_0034522 3300044712 Bacteria 7018
113 Ga0453684_0041156 3300044712 Bacteria 6256
114 Ga0453684_0042887 3300044712 Bacteria 6089
115 Ga0453684_0047557 3300044712 Bacteria 5687
116 Ga0453684_0050325 3300044712 Bacteria 5483
117 Ga0453684_0056782 3300044712 Bacteria 5075
118 Ga0453684_0074987 3300044712 Bacteria 4255
119 Ga0453684_0085673 3300044712 Bacteria 3913
120 Ga0453684_0107744 3300044712 Bacteria 3392
121 Ga0453684_0121300 3300044712 Bacteria 3155
122 Ga0453684_0154818 3300044712 Bacteria 2719
123 Ga0453684_0271336 3300044712 Bacteria 1938
124 Ga0453684_0280249 3300044712 Bacteria 1901
125 Ga0453684_0365818 3300044712 Bacteria 1623
126 Ga0453684_0367022 3300044712 Bacteria 1619
127 Ga0453684_0377124 3300044712 Bacteria 1593
128 Ga0453684_0522966 3300044712 Bacteria 1310
129 Ga0453684_0530022 3300044712 Unclassified 1300
130 Ga0453684_0540515 3300044712 Bacteria 1285
131 Ga0453684_0563525 3300044712 Bacteria 1253
132 Ga0453684_0664019 3300044712 Bacteria 1136
133 Ga0453684_0704504 3300044712 Bacteria 1097
134 Ga0453684_0794266 3300044712 Bacteria 1021
135 Ga0453684_0804122 3300044712 Bacteria 1014
136 Ga0453684_0822074 3300044712 Bacteria 1000
137 Ga0453684_1029838 3300044712 Unclassified 874
138 Ga0453684_1034958 3300044712 Bacteria 871
139 Ga0453684_1206312 3300044712 Bacteria 794
140 Ga0453684_1265498 3300044712 Bacteria 771
141 Ga0453684_1449980 3300044712 Bacteria 710
142 Ga0451576_0000069 3300045051 Bacteria 259862
143 Ga0451576_0000086 3300045051 Bacteria 235554
144 Ga0451576_0001339 3300045051 Bacteria 42606
145 Ga0451576_0003706 3300045051 Bacteria 20667
146 Ga0451576_0009925 3300045051 Bacteria 10991
147 Ga0451576_0015754 3300045051 Bacteria 8367
148 Ga0451576_0025333 3300045051 Bacteria 6391
149 Ga0451576_0032317 3300045051 Bacteria 5575
150 Ga0451576_0053646 3300045051 Bacteria 4222
151 Ga0451576_0152040 3300045051 Bacteria 2414
152 Ga0451576_0152354 3300045051 Bacteria 2411
153 Ga0451576_0217671 3300045051 Bacteria 1994
154 Ga0451576_0267883 3300045051 Bacteria 1786
155 Ga0451576_0327418 3300045051 Bacteria 1604
156 Ga0451576_0383257 3300045051 Unclassified 1474
157 Ga0451576_0430252 3300045051 Bacteria 1385
158 Ga0451576_0468391 3300045051 Bacteria 1323
159 Ga0451576_0478831 3300045051 Bacteria 1307
160 Ga0451576_0507025 3300045051 Bacteria 1267
161 Ga0451576_0547791 3300045051 Bacteria 1215
162 Ga0451576_0725256 3300045051 Bacteria 1044
163 Ga0451576_0758392 3300045051 Bacteria 1019
164 Ga0451576_0822413 3300045051 Bacteria 975
165 Ga0451576_0985022 3300045051 Bacteria 884
166 Ga0451576_1003586 3300045051 Bacteria 875
167 Ga0451576_1208658 3300045051 Bacteria 789
168 Ga0451576_1876631 3300045051 Bacteria 619
169 Ga0451576_1985122 3300045051 Unclassified 599
170 Ga0451576_2486607 3300045051 Bacteria 529
171 Ga0495635_0998038 3300046663 Bacteria 533
172 Ga0501031_0516734 3300049568 Bacteria 770
173 Ga0501032_0802850 3300049569 Unclassified 594
174 Ga0501036_1021124 3300049572 Bacteria 677
175 Ga0501040_0358522 3300049576 Unclassified 1045
176 Ga0501041_0049586 3300049577 Bacteria 2558
177 Ga0501042_0681414 3300049578 Unclassified 747
178 Ga0501048_0564479 3300049582 Unclassified 817
179 Ga0501071_0564268 3300049587 Unclassified 875
180 Ga0501071_1513211 3300049587 Unclassified 518
181 Ga0501074_0106128 3300049590 Bacteria 2011
182 Ga0501076_0119161 3300049592 Bacteria 2137
183 Ga0501077_0315325 3300049593 Unclassified 997
184 Ga0501035_0661366 3300049822 Unclassified 846
185 Ga0501045_0095941 3300049824 Bacteria 2194
186 Ga0501082_1654152 3300060353 Bacteria 559
187 Ga0530510_0274606 3300061734 Bacteria 1258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038741 Ga0400488_44441 Ga0400488_44441_12_395 127
2 3300044712 Ga0453684_0280249 Ga0453684_0280249_528_959 130
3 3300046663 Ga0495635_0998038 Ga0495635_0998038_32_436 134
4 3300042876 Ga0451577_0509559 Ga0451577_0509559_299_721 140
5 3300042876 Ga0451577_0547556 Ga0451577_0547556_207_629 140
6 3300044673 Ga0453683_0014364 Ga0453683_0014364_857_1279 140
7 3300044673 Ga0453683_0033463 Ga0453683_0033463_275_697 140
8 3300044673 Ga0453683_0445949 Ga0453683_0445949_338_760 140
9 3300044712 Ga0453684_0001947 Ga0453684_0001947_50711_51133 140
10 3300044712 Ga0453684_0004031 Ga0453684_0004031_30570_30992 140
11 3300044712 Ga0453684_0042887 Ga0453684_0042887_5183_5605 140
12 3300044712 Ga0453684_0271336 Ga0453684_0271336_139_561 140
13 3300045051 Ga0451576_0217671 Ga0451576_0217671_757_1179 140
14 3300045051 Ga0451576_0468391 Ga0451576_0468391_549_971 140
15 3300045051 Ga0451576_0478831 Ga0451576_0478831_339_761 140
16 3300045051 Ga0451576_0547791 Ga0451576_0547791_211_633 140
17 3300049569 Ga0501032_0802850 Ga0501032_0802850_17_439 140
18 3300049572 Ga0501036_1021124 Ga0501036_1021124_185_607 140
19 3300049576 Ga0501040_0358522 Ga0501040_0358522_334_756 140
20 3300049577 Ga0501041_0049586 Ga0501041_0049586_1014_1436 140
21 3300049578 Ga0501042_0681414 Ga0501042_0681414_261_683 140
22 3300049582 Ga0501048_0564479 Ga0501048_0564479_90_512 140
23 3300049587 Ga0501071_0564268 Ga0501071_0564268_75_497 140
24 3300049587 Ga0501071_1513211 Ga0501071_1513211_62_484 140
25 3300049590 Ga0501074_0106128 Ga0501074_0106128_1095_1517 140
26 3300049592 Ga0501076_0119161 Ga0501076_0119161_453_875 140
27 3300049593 Ga0501077_0315325 Ga0501077_0315325_80_502 140
28 3300049822 Ga0501035_0661366 Ga0501035_0661366_353_775 140
29 3300049824 Ga0501045_0095941 Ga0501045_0095941_655_1077 140
30 3300060353 Ga0501082_1654152 Ga0501082_1654152_34_456 140
31 3300061734 Ga0530510_0274606 Ga0530510_0274606_300_722 140
32 3300042876 Ga0451577_0000041 Ga0451577_0000041_218863_219288 141
33 3300042876 Ga0451577_0015594 Ga0451577_0015594_1926_2351 141
34 3300042876 Ga0451577_0145692 Ga0451577_0145692_1255_1710 141
35 3300042876 Ga0451577_0162923 Ga0451577_0162923_539_964 141
36 3300042876 Ga0451577_0333542 Ga0451577_0333542_757_1212 141
37 3300044673 Ga0453683_0000201 Ga0453683_0000201_65406_65861 141
38 3300044673 Ga0453683_0002096 Ga0453683_0002096_6872_7297 141
39 3300044673 Ga0453683_0073292 Ga0453683_0073292_1077_1532 141
40 3300044673 Ga0453683_0122568 Ga0453683_0122568_711_1166 141
41 3300044712 Ga0453684_0000066 Ga0453684_0000066_222676_223101 141
42 3300044712 Ga0453684_0003125 Ga0453684_0003125_34809_35261 141
43 3300044712 Ga0453684_0013641 Ga0453684_0013641_386_841 141
44 3300044712 Ga0453684_0030939 Ga0453684_0030939_852_1310 141
45 3300044712 Ga0453684_0031388 Ga0453684_0031388_4214_4666 141
46 3300044712 Ga0453684_0085673 Ga0453684_0085673_2491_2949 141
47 3300044712 Ga0453684_0121300 Ga0453684_0121300_344_799 141
48 3300044712 Ga0453684_0154818 Ga0453684_0154818_959_1384 141
49 3300044712 Ga0453684_0522966 Ga0453684_0522966_807_1262 141
50 3300044712 Ga0453684_0664019 Ga0453684_0664019_306_761 141
51 3300044712 Ga0453684_1449980 Ga0453684_1449980_271_696 141
52 3300045051 Ga0451576_0001339 Ga0451576_0001339_16643_17098 141
53 3300045051 Ga0451576_0003706 Ga0451576_0003706_4951_5406 141
54 3300045051 Ga0451576_0009925 Ga0451576_0009925_10303_10728 141
55 3300045051 Ga0451576_0032317 Ga0451576_0032317_4790_5245 141
56 3300045051 Ga0451576_0507025 Ga0451576_0507025_455_913 141
57 3300045051 Ga0451576_0725256 Ga0451576_0725256_383_841 141
58 3300045051 Ga0451576_0822413 Ga0451576_0822413_492_947 141
59 3300045051 Ga0451576_0985022 Ga0451576_0985022_236_661 141
60 3300049568 Ga0501031_0516734 Ga0501031_0516734_253_678 141
61 3300031240 Ga0265320_10454146 Ga0265320_104541461 142
62 3300005289 Ga0065704_10088852 Ga0065704_100888522 143
63 3300005295 Ga0065707_10101177 Ga0065707_101011773 143
64 3300028577 Ga0265318_10017436 Ga0265318_100174362 143
65 3300028653 Ga0265323_10003700 Ga0265323_100037007 143
66 3300028654 Ga0265322_10002327 Ga0265322_100023273 143
67 3300031235 Ga0265330_10011716 Ga0265330_100117163 143
68 3300031235 Ga0265330_10173103 Ga0265330_101731032 143
69 3300031239 Ga0265328_10044571 Ga0265328_100445712 143
70 3300031242 Ga0265329_10004147 Ga0265329_100041476 143
71 3300031249 Ga0265339_10008935 Ga0265339_100089355 143
72 3300031250 Ga0265331_10045000 Ga0265331_100450002 143
73 3300031250 Ga0265331_10193504 Ga0265331_101935042 143
74 3300031251 Ga0265327_10015465 Ga0265327_100154654 143
75 3300031251 Ga0265327_10280983 Ga0265327_102809832 143
76 3300031344 Ga0265316_10000285 Ga0265316_100002857 143
77 3300031344 Ga0265316_10063458 Ga0265316_100634582 143
78 3300031344 Ga0265316_10092515 Ga0265316_100925152 143
79 3300031711 Ga0265314_10008324 Ga0265314_100083244 143
80 3300031712 Ga0265342_10000980 Ga0265342_1000098023 143
81 3300031727 Ga0316576_11026577 Ga0316576_110265771 143
82 3300031727 Ga0316576_11051809 Ga0316576_110518091 143
83 3300031728 Ga0316578_10418099 Ga0316578_104180991 143
84 3300031733 Ga0316577_10047867 Ga0316577_100478674 143
85 3300031733 Ga0316577_10460155 Ga0316577_104601551 143
86 3300033524 Ga0316592_1160094 Ga0316592_11600941 143
87 3300035084 Ga0373928_0001117 Ga0373928_0001117_2449_2880 143
88 3300035398 Ga0316574_0002992 Ga0316574_0002992_723_1154 143
89 3300035398 Ga0316574_0324368 Ga0316574_0324368_49_480 143
90 3300036401 Ga0373937_0065819 Ga0373937_0065819_606_1037 143
91 3300036647 Ga0316582_0512949 Ga0316582_0512949_73_504 143
92 3300036647 Ga0316582_0845436 Ga0316582_0845436_122_553 143
93 3300036712 Ga0316584_0078626 Ga0316584_0078626_1512_1943 143
94 3300036712 Ga0316584_1025155 Ga0316584_1025155_16_447 143
95 3300036712 Ga0316584_1121945 Ga0316584_1121945_16_447 143
96 3300038741 Ga0400488_56113 Ga0400488_56113_3368_3799 143
97 3300039062 Ga0400483_231506 Ga0400483_231506_274_705 143
98 3300042876 Ga0451577_0000065 Ga0451577_0000065_58232_58663 143
99 3300042876 Ga0451577_0000158 Ga0451577_0000158_145120_145551 143
100 3300042876 Ga0451577_0000838 Ga0451577_0000838_20888_21319 143
101 3300042876 Ga0451577_0003601 Ga0451577_0003601_5246_5677 143
102 3300042876 Ga0451577_0007106 Ga0451577_0007106_833_1264 143
103 3300042876 Ga0451577_0044638 Ga0451577_0044638_1144_1575 143
104 3300042876 Ga0451577_0054572 Ga0451577_0054572_1199_1630 143
105 3300042876 Ga0451577_0058800 Ga0451577_0058800_2871_3302 143
106 3300042876 Ga0451577_0067892 Ga0451577_0067892_1002_1433 143
107 3300042876 Ga0451577_0081991 Ga0451577_0081991_614_1045 143
108 3300042876 Ga0451577_0101205 Ga0451577_0101205_902_1333 143
109 3300042876 Ga0451577_0106682 Ga0451577_0106682_1709_2140 143
110 3300042876 Ga0451577_0128874 Ga0451577_0128874_1042_1473 143
111 3300042876 Ga0451577_0176340 Ga0451577_0176340_71_502 143
112 3300042876 Ga0451577_0226661 Ga0451577_0226661_1230_1661 143
113 3300042876 Ga0451577_0348507 Ga0451577_0348507_621_1055 143
114 3300042876 Ga0451577_0797609 Ga0451577_0797609_238_669 143
115 3300042876 Ga0451577_0934106 Ga0451577_0934106_162_593 143
116 3300042876 Ga0451577_0973815 Ga0451577_0973815_19_450 143
117 3300042876 Ga0451577_0984111 Ga0451577_0984111_57_488 143
118 3300044673 Ga0453683_0000036 Ga0453683_0000036_212986_213417 143
119 3300044673 Ga0453683_0000081 Ga0453683_0000081_78862_79293 143
120 3300044673 Ga0453683_0000108 Ga0453683_0000108_111896_112354 143
121 3300044673 Ga0453683_0000193 Ga0453683_0000193_57683_58114 143
122 3300044673 Ga0453683_0000260 Ga0453683_0000260_20918_21349 143
123 3300044673 Ga0453683_0003816 Ga0453683_0003816_4071_4502 143
124 3300044673 Ga0453683_0014067 Ga0453683_0014067_2919_3350 143
125 3300044673 Ga0453683_0014960 Ga0453683_0014960_3703_4134 143
126 3300044673 Ga0453683_0018977 Ga0453683_0018977_2841_3272 143
127 3300044673 Ga0453683_0029620 Ga0453683_0029620_604_1035 143
128 3300044673 Ga0453683_0115872 Ga0453683_0115872_18_449 143
129 3300044673 Ga0453683_0129372 Ga0453683_0129372_376_807 143
130 3300044673 Ga0453683_0264815 Ga0453683_0264815_421_852 143
131 3300044673 Ga0453683_0575991 Ga0453683_0575991_265_696 143
132 3300044673 Ga0453683_0805860 Ga0453683_0805860_16_447 143
133 3300044673 Ga0453683_1082921 Ga0453683_1082921_17_448 143
134 3300044673 Ga0453683_1126754 Ga0453683_1126754_29_460 143
135 3300044712 Ga0453684_0000089 Ga0453684_0000089_296366_296797 143
136 3300044712 Ga0453684_0000184 Ga0453684_0000184_113826_114257 143
137 3300044712 Ga0453684_0000209 Ga0453684_0000209_222458_222889 143
138 3300044712 Ga0453684_0000349 Ga0453684_0000349_115133_115564 143
139 3300044712 Ga0453684_0000743 Ga0453684_0000743_58542_58973 143
140 3300044712 Ga0453684_0000883 Ga0453684_0000883_29698_30129 143
141 3300044712 Ga0453684_0001085 Ga0453684_0001085_26066_26497 143
142 3300044712 Ga0453684_0001242 Ga0453684_0001242_47920_48351 143
143 3300044712 Ga0453684_0002925 Ga0453684_0002925_27744_28202 143
144 3300044712 Ga0453684_0004714 Ga0453684_0004714_14037_14468 143
145 3300044712 Ga0453684_0005544 Ga0453684_0005544_9527_9958 143
146 3300044712 Ga0453684_0019613 Ga0453684_0019613_5674_6105 143
147 3300044712 Ga0453684_0021476 Ga0453684_0021476_1913_2344 143
148 3300044712 Ga0453684_0026044 Ga0453684_0026044_3725_4156 143
149 3300044712 Ga0453684_0026732 Ga0453684_0026732_1815_2246 143
150 3300044712 Ga0453684_0034522 Ga0453684_0034522_4283_4714 143
151 3300044712 Ga0453684_0041156 Ga0453684_0041156_5074_5505 143
152 3300044712 Ga0453684_0047557 Ga0453684_0047557_3318_3749 143
153 3300044712 Ga0453684_0050325 Ga0453684_0050325_3229_3660 143
154 3300044712 Ga0453684_0056782 Ga0453684_0056782_1151_1582 143
155 3300044712 Ga0453684_0074987 Ga0453684_0074987_514_945 143
156 3300044712 Ga0453684_0107744 Ga0453684_0107744_1940_2371 143
157 3300044712 Ga0453684_0365818 Ga0453684_0365818_362_793 143
158 3300044712 Ga0453684_0367022 Ga0453684_0367022_862_1293 143
159 3300044712 Ga0453684_0377124 Ga0453684_0377124_527_958 143
160 3300044712 Ga0453684_0530022 Ga0453684_0530022_658_1089 143
161 3300044712 Ga0453684_0540515 Ga0453684_0540515_718_1149 143
162 3300044712 Ga0453684_0563525 Ga0453684_0563525_454_885 143
163 3300044712 Ga0453684_0704504 Ga0453684_0704504_606_1037 143
164 3300044712 Ga0453684_0794266 Ga0453684_0794266_504_935 143
165 3300044712 Ga0453684_0804122 Ga0453684_0804122_93_524 143
166 3300044712 Ga0453684_0822074 Ga0453684_0822074_147_578 143
167 3300044712 Ga0453684_1029838 Ga0453684_1029838_296_727 143
168 3300044712 Ga0453684_1034958 Ga0453684_1034958_389_820 143
169 3300044712 Ga0453684_1206312 Ga0453684_1206312_335_766 143
170 3300044712 Ga0453684_1265498 Ga0453684_1265498_124_600 143
171 3300045051 Ga0451576_0000069 Ga0451576_0000069_241528_241959 143
172 3300045051 Ga0451576_0000086 Ga0451576_0000086_73150_73581 143
173 3300045051 Ga0451576_0015754 Ga0451576_0015754_6704_7135 143
174 3300045051 Ga0451576_0025333 Ga0451576_0025333_3849_4280 143
175 3300045051 Ga0451576_0053646 Ga0451576_0053646_3629_4060 143
176 3300045051 Ga0451576_0152040 Ga0451576_0152040_465_896 143
177 3300045051 Ga0451576_0152354 Ga0451576_0152354_1557_1991 143
178 3300045051 Ga0451576_0267883 Ga0451576_0267883_275_706 143
179 3300045051 Ga0451576_0327418 Ga0451576_0327418_170_601 143
180 3300045051 Ga0451576_0383257 Ga0451576_0383257_457_888 143
181 3300045051 Ga0451576_0430252 Ga0451576_0430252_712_1143 143
182 3300045051 Ga0451576_0758392 Ga0451576_0758392_499_930 143
183 3300045051 Ga0451576_1003586 Ga0451576_1003586_279_710 143
184 3300045051 Ga0451576_1208658 Ga0451576_1208658_211_711 143
185 3300045051 Ga0451576_1876631 Ga0451576_1876631_151_582 143
186 3300045051 Ga0451576_1985122 Ga0451576_1985122_75_506 143
187 3300045051 Ga0451576_2486607 Ga0451576_2486607_21_452 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19571

ACT_8

ACT domain pair

16

158

0.96

PF22629

AHAS-like_ACT

AHAS-like ACT domain

21

76

0.96

PF01842

ACT

ACT domain

20

77

0.95

PF01842

ACT

ACT domain

86

145

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.9524 1 143
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.9332 1 143
1sc6-assembly1.cif.gz_A crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+ 0.836 3 60
3k5p-assembly1.cif.gz_A crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis 0.8297 3 68
1sc6-assembly1.cif.gz_C crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+ 0.8269 3 60
ID Description Score Start End Superfamily
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9503 2 143 3.30.2130.10
af_K7N190_5_82_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9246 5 49 3.90.550.10
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9245 2 143 3.30.2130.10
af_O81900_105_207_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8961 3 49 3.30.70.260
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8901 3 49 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7Z9Y8D1-F1-model_v4 ACT domain-containing protein 0.9937 1 70
AF-A0A3B8ZRS9-F1-model_v4 deleted 0.9918 1 70
AF-A0A7V5ANL2-F1-model_v4 Amino acid-binding protein 0.9871 1 70
AF-A0A1V5TXU0-F1-model_v4 ACT domain-containing protein 0.9867 3 141
AF-R7L2V9-F1-model_v4 ACT domain-containing protein 0.9864 1 141

Feature Viewer

pLDDT pTM Quality
93.23 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map