F288053

General Info

Members Datasets Scaffolds Average Seq Length
187 138 374 244

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0127353|Ga0436363_0127353_1615_2427
Length 270
Sequence MNSRTLTRRHFAQSSFIAGAALVSGERSAFSQEVSAGAARPAAITNVVLTHGAFADGSSWSKVIPLLEAQGLNVTAVQNPLTSLADDIATTRRLLAQQDGPTILVGHSYAGFVITEAGNAPNVAGLVYISSYGPDKGESHDDLVKRFPAPGGISAIQLDQDGFLWIARDKFHEAFVHEVDASYACILATVQKPASKKGCFGVPIDAPAWKSKRSWFLVSTEDRLISPDLQRFMAKRMGATVRMIPSSHASLISHPTQTADLILDATRSLG

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
128 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
129 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
133 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
134 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
135 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
136 2885198086 Variovorax sp. 679 Isolate Unclassified
137 2885211737 Variovorax sp. 553 Isolate Unclassified
138 2928084124 Variovorax paradoxus 1218 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 1.07
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 2.67
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0127353 3300039450 Bacteria 2907
2 JGI25151J46595_10000769 3300003187 Bacteria 25987
3 Ga0070690_100001134 3300005330 Bacteria 13692
4 Ga0070677_10229486 3300005333 Bacteria 911
5 Ga0068869_100023236 3300005334 Bacteria 4279
6 Ga0070666_10524228 3300005335 Bacteria 860
7 Ga0070680_100062714 3300005336 Bacteria 3044
8 Ga0070669_100027633 3300005353 Bacteria 4084
9 Ga0070673_100029194 3300005364 Bacteria 4111
10 Ga0070688_100034141 3300005365 Bacteria 3079
11 Ga0070688_100134387 3300005365 Bacteria 1673
12 Ga0070659_100210039 3300005366 Bacteria 1604
13 Ga0070705_100497727 3300005440 Bacteria 924
14 Ga0070694_100172824 3300005444 Bacteria 1593
15 Ga0070694_100688162 3300005444 Bacteria 831
16 Ga0070708_100184401 3300005445 Bacteria 1951
17 Ga0070685_10021518 3300005466 Bacteria 3507
18 Ga0070707_100053431 3300005468 Bacteria 3873
19 Ga0070707_100129027 3300005468 Bacteria 2457
20 Ga0070698_100172916 3300005471 Bacteria 2100
21 Ga0070699_100119630 3300005518 Bacteria 2315
22 Ga0070699_100164541 3300005518 Bacteria 1964
23 Ga0070684_100209721 3300005535 Bacteria 1775
24 Ga0070697_100002301 3300005536 Bacteria 14669
25 Ga0070697_100171340 3300005536 Bacteria 1837
26 Ga0070672_100344160 3300005543 Bacteria 1270
27 Ga0070672_100448548 3300005543 Bacteria 1111
28 Ga0070696_100046337 3300005546 Bacteria 3015
29 Ga0070665_100052803 3300005548 Bacteria 4076
30 Ga0070665_100256174 3300005548 Bacteria 1751
31 Ga0068857_100299708 3300005577 Bacteria 1482
32 Ga0068854_100104366 3300005578 Bacteria 2129
33 Ga0068859_100011633 3300005617 Bacteria 8847
34 Ga0068859_100475417 3300005617 Bacteria 1345
35 Ga0068861_100079021 3300005719 Bacteria 2571
36 Ga0068861_100146783 3300005719 Bacteria 1931
37 Ga0068863_100339167 3300005841 Bacteria 1462
38 Ga0068858_100346837 3300005842 Bacteria 1422
39 Ga0068858_100748926 3300005842 Bacteria 952
40 Ga0068862_100094243 3300005844 Bacteria 2611
41 Ga0070715_10000026 3300006163 Bacteria 97907
42 Ga0097621_100450572 3300006237 Bacteria 1159
43 Ga0075370_10010023 3300006353 Bacteria 4941
44 Ga0075428_100011520 3300006844 Bacteria 9836
45 Ga0075430_100009028 3300006846 Bacteria 8427
46 Ga0075430_100009319 3300006846 Bacteria 8298
47 Ga0075431_100003661 3300006847 Bacteria 14912
48 Ga0075431_100639879 3300006847 Bacteria 1045
49 Ga0075429_100026551 3300006880 Bacteria 5029
50 Ga0075436_100031619 3300006914 Bacteria 3646
51 Ga0097620_100011633 3300006931 Bacteria 8847
52 Ga0097620_100475347 3300006931 Bacteria 1345
53 Ga0099794_10292848 3300007265 Bacteria 842
54 Ga0105244_10007685 3300009036 Bacteria 6830
55 Ga0111539_10048302 3300009094 Bacteria 5082
56 Ga0114129_10037878 3300009147 Bacteria 6805
57 Ga0114129_10159577 3300009147 Bacteria 3082
58 Ga0114129_10254428 3300009147 Bacteria 2356
59 Ga0114129_10953981 3300009147 Bacteria 1083
60 Ga0114129_10997354 3300009147 Bacteria 1055
61 Ga0105243_10010674 3300009148 Bacteria 6964
62 Ga0105243_10370866 3300009148 Bacteria 1321
63 Ga0105242_10001236 3300009176 Bacteria 20151
64 Ga0105242_10006959 3300009176 Bacteria 8728
65 Ga0105249_10172949 3300009553 Bacteria 2096
66 Ga0157378_10000311 3300013297 Bacteria 47572
67 Ga0157375_10001633 3300013308 Bacteria 19282
68 Ga0163163_10205876 3300014325 Bacteria 2016
69 Ga0157380_10036815 3300014326 Bacteria 3788
70 Ga0157376_11131431 3300014969 Bacteria 809
71 Ga0163161_10147685 3300017792 Bacteria 1785
72 Ga0209129_1005596 3300025258 Bacteria 4374
73 Ga0209025_1000238 3300025294 Bacteria 128478
74 Ga0207655_1036163 3300025728 Bacteria 2193
75 Ga0207685_10000009 3300025905 Bacteria 242842
76 Ga0207643_10032375 3300025908 Bacteria 2920
77 Ga0207646_10072257 3300025922 Bacteria 3081
78 Ga0207646_10170706 3300025922 Bacteria 1964
79 Ga0207646_10303463 3300025922 Bacteria 1442
80 Ga0207681_10190670 3300025923 Bacteria 1568
81 Ga0207686_10000301 3300025934 Bacteria 36070
82 Ga0207686_10006025 3300025934 Bacteria 6509
83 Ga0207709_10002359 3300025935 Bacteria 11919
84 Ga0207709_10241255 3300025935 Bacteria 1315
85 Ga0207691_10287837 3300025940 Bacteria 1413
86 Ga0207711_10003716 3300025941 Bacteria 13153
87 Ga0207711_10201510 3300025941 Bacteria 1816
88 Ga0207689_10048142 3300025942 Bacteria 3516
89 Ga0207651_10021009 3300025960 Bacteria 3956
90 Ga0207651_10026868 3300025960 Bacteria 3605
91 Ga0207641_10275536 3300026088 Bacteria 1580
92 Ga0207648_10050664 3300026089 Bacteria 3630
93 Ga0207648_10510119 3300026089 Bacteria 1101
94 Ga0207675_100108867 3300026118 Bacteria 2614
95 Ga0209588_1017975 3300027671 Bacteria 2198
96 Ga0307511_10125510 3300030521 Bacteria 1568
97 Ga0307512_10003372 3300030522 Bacteria 18700
98 Ga0265770_1000074 3300030878 Bacteria 11125
99 Ga0265760_10000177 3300031090 Bacteria 16628
100 Ga0307513_10176167 3300031456 Bacteria 2008
101 Ga0307508_10026289 3300031616 Bacteria 5275
102 Ga0307508_10048341 3300031616 Bacteria 3789
103 Ga0307508_10424718 3300031616 Bacteria 921
104 Ga0307405_10502183 3300031731 Bacteria 972
105 Ga0307409_101153323 3300031995 Bacteria 797
106 Ga0307416_100018304 3300032002 Bacteria 4931
107 Ga0373937_0007332 3300036401 Bacteria 9548
108 Ga0373925_0000020 3300037068 Bacteria 170299
109 Ga0453684_0640193 3300044712 Unclassified 1161
110 Ga0451576_0331072 3300045051 Unclassified 1594
111 Ga0495629_0132611 3300046459 Bacteria 1735
112 Ga0495638_0004410 3300046460 Bacteria 10656
113 Ga0495580_0130673 3300046472 Bacteria 1742
114 Ga0495580_0234042 3300046472 Bacteria 1260
115 Ga0495582_0002441 3300046473 Bacteria 10362
116 Ga0495582_0143340 3300046473 Bacteria 1355
117 Ga0495616_0008237 3300046513 Bacteria 6187
118 Ga0495631_0004305 3300046518 Bacteria 7595
119 Ga0495652_0338526 3300046529 Bacteria 1082
120 Ga0495654_0002620 3300046530 Bacteria 11464
121 Ga0495654_0017153 3300046530 Bacteria 3812
122 Ga0495668_0000046 3300046616 Bacteria 224203
123 Ga0495668_0241789 3300046616 Bacteria 988
124 Ga0495625_0078287 3300046660 Bacteria 2308
125 Ga0495588_0026166 3300046674 Bacteria 2911
126 Ga0495588_0095794 3300046674 Bacteria 1556
127 Ga0495658_0001529 3300046683 Bacteria 12139
128 Ga0495658_0031392 3300046683 Bacteria 2894
129 Ga0495670_0104440 3300046691 Bacteria 1462
130 Ga0495660_0039702 3300046810 Bacteria 2613
131 Ga0495660_0052397 3300046810 Bacteria 2217
132 Ga0495672_0063122 3300047320 Bacteria 2127
133 Ga0495687_067810 3300047443 Bacteria 1442
134 Ga0495675_0068299 3300047444 Bacteria 2245
135 Ga0495685_010352 3300047447 Bacteria 3125
136 Ga0495681_0011671 3300047470 Bacteria 5214
137 Ga0495686_0001713 3300047472 Bacteria 22633
138 Ga0495593_0007135 3300047673 Bacteria 6551
139 Ga0495614_0001100 3300048089 Bacteria 11572
140 Ga0496102_0083367 3300048905 Bacteria 2950
141 Ga0496104_0146809 3300048907 Bacteria 2265
142 Ga0496106_0010157 3300048909 Bacteria 6955
143 Ga0496106_0046907 3300048909 Bacteria 3249
144 Ga0496112_0054416 3300048915 Bacteria 3932
145 Ga0496118_0160945 3300048921 Bacteria 1388
146 Ga0496121_0039952 3300048924 Bacteria 4124
147 nmdc:mga07m45_3811_c1 3300050496 Bacteria 7296
148 nmdc:mga05p37_21272_c1 3300050507 Bacteria 7853
149 nmdc:mga05p37_242030_c1 3300050507 Bacteria 2169
150 nmdc:mga05p37_402201_c1 3300050507 Bacteria 1599
151 nmdc:mga05p37_429357_c1 3300050507 Bacteria 1535
152 nmdc:mga05p37_507950_c1 3300050507 Bacteria 1382
153 nmdc:mga05p37_743113_c1 3300050507 Unclassified 1083
154 nmdc:mga05p37_773985_c1 3300050507 Bacteria 1054
155 nmdc:mga09592_117362_c1 3300050508 Unclassified 2284
156 nmdc:mga09592_3812_c1 3300050508 Bacteria 12139
157 nmdc:mga0qj67_15381_c1 3300050509 Bacteria 5793
158 nmdc:mga0qj67_273438_c1 3300050509 Unclassified 1369
159 nmdc:mga0qj67_3926_c1 3300050509 Bacteria 10754
160 nmdc:mga06r32_367399_c1 3300050510 Unclassified 1422
161 nmdc:mga06r32_7380_c1 3300050510 Bacteria 9893
162 nmdc:mga0rr50_656967_c1 3300050513 Bacteria 895
163 nmdc:mga08x19_31949_c1 3300050514 Bacteria 3316
164 nmdc:mga08x19_346425_c1 3300050514 Bacteria 1037
165 nmdc:mga0a205_253971_c1 3300050515 Bacteria 1637
166 Ga0500610_0003894 3300053079 Bacteria 5819
167 Ga0500610_0059462 3300053079 Bacteria 1994
168 Ga0495655_0004110 3300053083 Bacteria 2465
169 Ga0495595_0176035 3300053084 Bacteria 1060
170 Ga0500644_0008011 3300053088 Bacteria 2773
171 Ga0500651_0000395 3300053093 Bacteria 23711
172 Ga0500566_0053658 3300053094 Bacteria 2300
173 Ga0500556_0008432 3300053104 Bacteria 2972
174 Ga0500562_003871 3300053108 Bacteria 3773
175 Ga0500571_000093 3300053110 Bacteria 29025
176 Ga0500658_0000351 3300053134 Bacteria 20488
177 Ga0500658_0000446 3300053134 Bacteria 17608
178 Ga0500564_025280 3300053138 Bacteria 2727
179 Ga0500568_0026054 3300053139 Bacteria 2457
180 Ga0500616_0052325 3300053153 Bacteria 2147
181 Ga0500627_0145850 3300053158 Bacteria 1069
182 Ga0500633_0034130 3300053160 Bacteria 1666
183 Ga0500634_0061602 3300053161 Bacteria 1989
184 Ga0500638_004694 3300053162 Bacteria 5323
185 2885203459 2885198086 Bacteria 7212419
186 2885217191 2885211737 Bacteria 7212420
187 2928088660 2928084124 Bacteria 7159212
188 Ga0436363_0127353
189 JGI25151J46595_10000769
190 Ga0070690_100001134
191 Ga0070677_10229486
192 Ga0068869_100023236
193 Ga0070666_10524228
194 Ga0070680_100062714
195 Ga0070669_100027633
196 Ga0070673_100029194
197 Ga0070688_100034141
198 Ga0070688_100134387
199 Ga0070659_100210039
200 Ga0070705_100497727
201 Ga0070694_100172824
202 Ga0070694_100688162
203 Ga0070708_100184401
204 Ga0070685_10021518
205 Ga0070707_100053431
206 Ga0070707_100129027
207 Ga0070698_100172916
208 Ga0070699_100119630
209 Ga0070699_100164541
210 Ga0070684_100209721
211 Ga0070697_100002301
212 Ga0070697_100171340
213 Ga0070672_100344160
214 Ga0070672_100448548
215 Ga0070696_100046337
216 Ga0070665_100052803
217 Ga0070665_100256174
218 Ga0068857_100299708
219 Ga0068854_100104366
220 Ga0068859_100011633
221 Ga0068859_100475417
222 Ga0068861_100079021
223 Ga0068861_100146783
224 Ga0068863_100339167
225 Ga0068858_100346837
226 Ga0068858_100748926
227 Ga0068862_100094243
228 Ga0070715_10000026
229 Ga0097621_100450572
230 Ga0075370_10010023
231 Ga0075428_100011520
232 Ga0075430_100009028
233 Ga0075430_100009319
234 Ga0075431_100003661
235 Ga0075431_100639879
236 Ga0075429_100026551
237 Ga0075436_100031619
238 Ga0097620_100011633
239 Ga0097620_100475347
240 Ga0099794_10292848
241 Ga0105244_10007685
242 Ga0111539_10048302
243 Ga0114129_10037878
244 Ga0114129_10159577
245 Ga0114129_10254428
246 Ga0114129_10953981
247 Ga0114129_10997354
248 Ga0105243_10010674
249 Ga0105243_10370866
250 Ga0105242_10001236
251 Ga0105242_10006959
252 Ga0105249_10172949
253 Ga0157378_10000311
254 Ga0157375_10001633
255 Ga0163163_10205876
256 Ga0157380_10036815
257 Ga0157376_11131431
258 Ga0163161_10147685
259 Ga0209129_1005596
260 Ga0209025_1000238
261 Ga0207655_1036163
262 Ga0207685_10000009
263 Ga0207643_10032375
264 Ga0207646_10072257
265 Ga0207646_10170706
266 Ga0207646_10303463
267 Ga0207681_10190670
268 Ga0207686_10000301
269 Ga0207686_10006025
270 Ga0207709_10002359
271 Ga0207709_10241255
272 Ga0207691_10287837
273 Ga0207711_10003716
274 Ga0207711_10201510
275 Ga0207689_10048142
276 Ga0207651_10021009
277 Ga0207651_10026868
278 Ga0207641_10275536
279 Ga0207648_10050664
280 Ga0207648_10510119
281 Ga0207675_100108867
282 Ga0209588_1017975
283 Ga0307511_10125510
284 Ga0307512_10003372
285 Ga0265770_1000074
286 Ga0265760_10000177
287 Ga0307513_10176167
288 Ga0307508_10026289
289 Ga0307508_10048341
290 Ga0307508_10424718
291 Ga0307405_10502183
292 Ga0307409_101153323
293 Ga0307416_100018304
294 Ga0373937_0007332
295 Ga0373925_0000020
296 Ga0453684_0640193
297 Ga0451576_0331072
298 Ga0495629_0132611
299 Ga0495638_0004410
300 Ga0495580_0130673
301 Ga0495580_0234042
302 Ga0495582_0002441
303 Ga0495582_0143340
304 Ga0495616_0008237
305 Ga0495631_0004305
306 Ga0495652_0338526
307 Ga0495654_0002620
308 Ga0495654_0017153
309 Ga0495668_0000046
310 Ga0495668_0241789
311 Ga0495625_0078287
312 Ga0495588_0026166
313 Ga0495588_0095794
314 Ga0495658_0001529
315 Ga0495658_0031392
316 Ga0495670_0104440
317 Ga0495660_0039702
318 Ga0495660_0052397
319 Ga0495672_0063122
320 Ga0495687_067810
321 Ga0495675_0068299
322 Ga0495685_010352
323 Ga0495681_0011671
324 Ga0495686_0001713
325 Ga0495593_0007135
326 Ga0495614_0001100
327 Ga0496102_0083367
328 Ga0496104_0146809
329 Ga0496106_0010157
330 Ga0496106_0046907
331 Ga0496112_0054416
332 Ga0496118_0160945
333 Ga0496121_0039952
334 nmdc:mga07m45_3811_c1
335 nmdc:mga05p37_21272_c1
336 nmdc:mga05p37_242030_c1
337 nmdc:mga05p37_402201_c1
338 nmdc:mga05p37_429357_c1
339 nmdc:mga05p37_507950_c1
340 nmdc:mga05p37_743113_c1
341 nmdc:mga05p37_773985_c1
342 nmdc:mga09592_117362_c1
343 nmdc:mga09592_3812_c1
344 nmdc:mga0qj67_15381_c1
345 nmdc:mga0qj67_273438_c1
346 nmdc:mga0qj67_3926_c1
347 nmdc:mga06r32_367399_c1
348 nmdc:mga06r32_7380_c1
349 nmdc:mga0rr50_656967_c1
350 nmdc:mga08x19_31949_c1
351 nmdc:mga08x19_346425_c1
352 nmdc:mga0a205_253971_c1
353 Ga0500610_0003894
354 Ga0500610_0059462
355 Ga0495655_0004110
356 Ga0495595_0176035
357 Ga0500644_0008011
358 Ga0500651_0000395
359 Ga0500566_0053658
360 Ga0500556_0008432
361 Ga0500562_003871
362 Ga0500571_000093
363 Ga0500658_0000351
364 Ga0500658_0000446
365 Ga0500564_025280
366 Ga0500568_0026054
367 Ga0500616_0052325
368 Ga0500627_0145850
369 Ga0500633_0034130
370 Ga0500634_0061602
371 Ga0500638_004694
372 2885203459
373 2885217191
374 2928088660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

47

261

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.9115 17 240
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.9086 21 240
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.9015 21 240
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8969 19 237
5y51-assembly4.cif.gz_D crystal structure of pyth_h230a 0.8822 18 240
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9565 19 241 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9279 19 241 3.40.50.1820
af_Q8S9K8_14_275_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.846 18 241 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8427 20 239 3.40.50.1820
af_Q0JG99_6_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8407 18 241 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A528B0L5-F1-model_v4 Alpha/beta hydrolase 1.001 20 105 GO:0016787
AF-G0FR54-F1-model_v4 deleted 0.9971 18 241
AF-A0A7U9KPQ2-F1-model_v4 Alpha/beta hydrolase 0.9969 30 240 GO:0016787
AF-D0VYN4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9951 18 230
AF-A0A2V8CYJ3-F1-model_v4 Alpha/beta hydrolase 0.995 81 245 GO:0016787

Map