F288025
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 152 | 374 | 366 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0001237|Ga0395905_0001237_7637_8851 |
| Length | 404 |
| Sequence | MHDDPSGKTLIFTVENDIRIVPATTMQQTSFSFSSSPFSSAPRVLRRSPGLCLPKFNEIYVQQAIERDPEWQARAERILKLFPGAELIPVESHWKIPELRSADPAEWIRSKKSALILGIKSGLKHVTNGRSADFIAASISNGCLSACQYCYVARRKGGSNPLTLFMNIEEIADSIEKHQEKLGPKTEPNSCDPNFWTYDIGCNADLSLDALICDHPGYMIERFAEMRFAKATFATKTVNDEYWLSYDPKGRTRIRYSLMPQAIARFVDIRTSPISVRIQSVNQLVDAGYEVHLNFSPIIIYGGGQWKSDWLALFQEIDQTLTPRAKAQLACEAFFLSHSAEAHELNLQWNPKGEEFLWKPEMQEPKKTKPDVLVYQYALKRRELSWFESTLARELPYCSVRYSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 8 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 9 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 10 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 11 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 13 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 14 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 19 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 20 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 21 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 22 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 23 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 24 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 25 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 26 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 27 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 28 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 29 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 30 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 31 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 32 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 33 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 34 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 35 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 36 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 37 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 38 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 39 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 40 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 41 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 42 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 43 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 44 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 45 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 46 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 47 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 48 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 62 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 63 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 64 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 66 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 67 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 68 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 73 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 74 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 78 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 82 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 83 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 84 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 85 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 86 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 87 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 88 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 89 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 90 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 91 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 92 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 93 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 94 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 95 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 96 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 97 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 98 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 99 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 100 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 101 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 102 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 103 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 104 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 105 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 106 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 107 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 108 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 109 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 110 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 111 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 112 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 113 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 114 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 115 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 116 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 117 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 118 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 119 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 120 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 121 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 122 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 123 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 124 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 125 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 126 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 127 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 128 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 129 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 130 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 131 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 132 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 133 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 134 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 135 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 136 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 137 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 138 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 139 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 140 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 141 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 142 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 143 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 144 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 145 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 146 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 147 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 148 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 149 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 150 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 151 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 152 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.1 |
| Metatranscriptomes | 0 |
| Isolates | 36.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.07 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 1.6 |
| Rhizoplane | 0 |
| Rhizosphere | 73.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0001237 | 3300037471 | Bacteria | 31722 |
| 2 | rootH2_10062616 | 3300003320 | Bacteria | 3622 |
| 3 | Ga0070689_100018932 | 3300005340 | Bacteria | 5083 |
| 4 | Ga0070700_100000075 | 3300005441 | Bacteria | 68207 |
| 5 | Ga0070662_100086979 | 3300005457 | Bacteria | 2339 |
| 6 | Ga0070702_100132174 | 3300005615 | Bacteria | 1578 |
| 7 | Ga0068859_100165079 | 3300005617 | Bacteria | 2294 |
| 8 | Ga0075364_10112338 | 3300006051 | Bacteria | 1819 |
| 9 | Ga0097620_100165084 | 3300006931 | Bacteria | 2294 |
| 10 | Ga0105239_10348146 | 3300010375 | Bacteria | 1673 |
| 11 | Ga0157370_10129630 | 3300013104 | Bacteria | 2353 |
| 12 | Ga0157369_10352534 | 3300013105 | Bacteria | 1528 |
| 13 | Ga0157379_10226599 | 3300014968 | Bacteria | 1694 |
| 14 | Ga0207688_10032647 | 3300025901 | Bacteria | 2878 |
| 15 | Ga0207706_10212052 | 3300025933 | Bacteria | 1697 |
| 16 | Ga0207640_10072845 | 3300025981 | Bacteria | 2319 |
| 17 | Ga0207708_10000097 | 3300026075 | Bacteria | 67533 |
| 18 | Ga0307408_100009948 | 3300031548 | Bacteria | 6264 |
| 19 | Ga0307405_10077383 | 3300031731 | Bacteria | 2161 |
| 20 | Ga0307413_10004553 | 3300031824 | Bacteria | 6050 |
| 21 | Ga0307413_10218250 | 3300031824 | Bacteria | 1391 |
| 22 | Ga0307410_10014158 | 3300031852 | Bacteria | 4682 |
| 23 | Ga0307406_10082309 | 3300031901 | Bacteria | 2143 |
| 24 | Ga0307407_10009514 | 3300031903 | Bacteria | 4531 |
| 25 | Ga0307412_10043897 | 3300031911 | Bacteria | 2914 |
| 26 | Ga0307412_10059515 | 3300031911 | Bacteria | 2560 |
| 27 | Ga0307416_100012313 | 3300032002 | Bacteria | 5757 |
| 28 | Ga0307416_100070882 | 3300032002 | Bacteria | 2892 |
| 29 | Ga0307416_100098107 | 3300032002 | Bacteria | 2540 |
| 30 | Ga0307414_10019989 | 3300032004 | Bacteria | 4163 |
| 31 | Ga0307411_10012020 | 3300032005 | Bacteria | 4702 |
| 32 | Ga0307411_10120405 | 3300032005 | Bacteria | 1898 |
| 33 | Ga0307415_100170265 | 3300032126 | Bacteria | 1698 |
| 34 | Ga0307415_100388238 | 3300032126 | Bacteria | 1188 |
| 35 | Ga0395899_0001272 | 3300037312 | Bacteria | 21924 |
| 36 | Ga0395900_0332014 | 3300037418 | Bacteria | 1498 |
| 37 | Ga0436364_0440931 | 3300037853 | Bacteria | 3072 |
| 38 | Ga0395901_0067976 | 3300038443 | Bacteria | 3712 |
| 39 | Ga0451837_0728164 | 3300041494 | Bacteria | 2606 |
| 40 | Ga0439433_0016418 | 3300041999 | Bacteria | 1640 |
| 41 | Ga0439457_003055 | 3300042014 | Bacteria | 4631 |
| 42 | Ga0466972_0016880 | 3300044658 | Bacteria | 3651 |
| 43 | Ga0466966_0002207 | 3300044684 | Bacteria | 12654 |
| 44 | Ga0466961_0026582 | 3300044693 | Bacteria | 3720 |
| 45 | Ga0466961_0056723 | 3300044693 | Bacteria | 2496 |
| 46 | Ga0466961_0101419 | 3300044693 | Bacteria | 1813 |
| 47 | Ga0466963_0000103 | 3300044694 | Bacteria | 30319 |
| 48 | Ga0466963_0000541 | 3300044694 | Bacteria | 17780 |
| 49 | Ga0466963_0055604 | 3300044694 | Bacteria | 2632 |
| 50 | Ga0466963_0087169 | 3300044694 | Bacteria | 2122 |
| 51 | Ga0466963_0102336 | 3300044694 | Bacteria | 1962 |
| 52 | Ga0466963_0151740 | 3300044694 | Bacteria | 1609 |
| 53 | Ga0466971_0003177 | 3300044719 | Bacteria | 7009 |
| 54 | Ga0466971_0008143 | 3300044719 | Bacteria | 4570 |
| 55 | Ga0466970_0016768 | 3300044765 | Bacteria | 3780 |
| 56 | Ga0466970_0052589 | 3300044765 | Bacteria | 2174 |
| 57 | Ga0466970_0070772 | 3300044765 | Bacteria | 1876 |
| 58 | Ga0466957_0007854 | 3300044842 | Bacteria | 6047 |
| 59 | Ga0466957_0316105 | 3300044842 | Bacteria | 1052 |
| 60 | Ga0466960_0007198 | 3300044901 | Bacteria | 4505 |
| 61 | Ga0466959_0000245 | 3300045049 | Bacteria | 33869 |
| 62 | Ga0466959_0245432 | 3300045049 | Bacteria | 1236 |
| 63 | Ga0451576_0008509 | 3300045051 | Bacteria | 12036 |
| 64 | Ga0466958_0000070 | 3300045836 | Bacteria | 30511 |
| 65 | Ga0466958_0050785 | 3300045836 | Bacteria | 2510 |
| 66 | Ga0466958_0072951 | 3300045836 | Bacteria | 2102 |
| 67 | Ga0466967_0682117 | 3300045976 | Bacteria | 1017 |
| 68 | Ga0495592_0043422 | 3300046454 | Bacteria | 3363 |
| 69 | Ga0495629_0062404 | 3300046459 | Bacteria | 2603 |
| 70 | Ga0495651_0042125 | 3300046462 | Bacteria | 3546 |
| 71 | Ga0495628_0075798 | 3300046516 | Bacteria | 2619 |
| 72 | Ga0495640_0014769 | 3300046533 | Bacteria | 5898 |
| 73 | Ga0495609_0116938 | 3300046538 | Bacteria | 1148 |
| 74 | Ga0495668_0001115 | 3300046616 | Bacteria | 27695 |
| 75 | Ga0495657_0045137 | 3300046675 | Bacteria | 2992 |
| 76 | Ga0495623_0021216 | 3300046679 | Bacteria | 4196 |
| 77 | Ga0495613_0007447 | 3300046689 | Bacteria | 8158 |
| 78 | Ga0495604_0023757 | 3300047317 | Bacteria | 4892 |
| 79 | Ga0495676_0001746 | 3300047321 | Bacteria | 18981 |
| 80 | Ga0495675_0038208 | 3300047444 | Bacteria | 3056 |
| 81 | Ga0496120_0108389 | 3300048923 | Bacteria | 1455 |
| 82 | Ga0496122_0038055 | 3300048925 | Bacteria | 3861 |
| 83 | Ga0496124_0000040 | 3300048927 | Bacteria | 307061 |
| 84 | Ga0496124_0037023 | 3300048927 | Bacteria | 4247 |
| 85 | Ga0496124_0061551 | 3300048927 | Bacteria | 3146 |
| 86 | Ga0501031_0047215 | 3300049568 | Bacteria | 2807 |
| 87 | Ga0501032_0061616 | 3300049569 | Bacteria | 2514 |
| 88 | Ga0501032_0093961 | 3300049569 | Bacteria | 1988 |
| 89 | Ga0501033_0003893 | 3300049570 | Bacteria | 12134 |
| 90 | Ga0501033_0009461 | 3300049570 | Bacteria | 7504 |
| 91 | Ga0501034_0008001 | 3300049571 | Bacteria | 11220 |
| 92 | Ga0501036_0008813 | 3300049572 | Bacteria | 8280 |
| 93 | Ga0501036_0023498 | 3300049572 | Bacteria | 5193 |
| 94 | Ga0501036_0028086 | 3300049572 | Bacteria | 4756 |
| 95 | Ga0501037_0068980 | 3300049573 | Bacteria | 2574 |
| 96 | Ga0501038_0013583 | 3300049574 | Bacteria | 7420 |
| 97 | Ga0501039_0004318 | 3300049575 | Bacteria | 10718 |
| 98 | Ga0501039_0079457 | 3300049575 | Bacteria | 2552 |
| 99 | Ga0501042_0004745 | 3300049578 | Bacteria | 8677 |
| 100 | Ga0501043_0005075 | 3300049579 | Bacteria | 10652 |
| 101 | Ga0501043_0016962 | 3300049579 | Bacteria | 5708 |
| 102 | Ga0501043_0018729 | 3300049579 | Bacteria | 5431 |
| 103 | Ga0501046_0015718 | 3300049580 | Bacteria | 6352 |
| 104 | Ga0501046_0016784 | 3300049580 | Bacteria | 6121 |
| 105 | Ga0501047_0045905 | 3300049581 | Bacteria | 4223 |
| 106 | Ga0501047_0162145 | 3300049581 | Bacteria | 2107 |
| 107 | Ga0501047_0189676 | 3300049581 | Bacteria | 1919 |
| 108 | Ga0501068_0091410 | 3300049584 | Bacteria | 1878 |
| 109 | Ga0501068_0190064 | 3300049584 | Bacteria | 1300 |
| 110 | Ga0501070_0000906 | 3300049586 | Bacteria | 27001 |
| 111 | Ga0501070_0031869 | 3300049586 | Bacteria | 4415 |
| 112 | Ga0501074_0023822 | 3300049590 | Bacteria | 4450 |
| 113 | Ga0501035_0003107 | 3300049822 | Bacteria | 15953 |
| 114 | Ga0501035_0393137 | 3300049822 | Bacteria | 1154 |
| 115 | Ga0501044_0019659 | 3300049823 | Bacteria | 7220 |
| 116 | Ga0501045_0161277 | 3300049824 | Bacteria | 1669 |
| 117 | Ga0590071_014063 | 3300059421 | Bacteria | 1875 |
| 118 | Ga0466962_0014796 | 3300061719 | Bacteria | 3759 |
| 119 | 2545677266 | 2545555834 | Bacteria | 8130841 |
| 120 | 2547405536 | 2547132111 | Bacteria | 8013147 |
| 121 | 2554260298 | 2554235005 | Bacteria | 6457341 |
| 122 | 2596377024 | 2595698237 | Bacteria | 6712432 |
| 123 | 2643763315 | 2643221548 | Bacteria | 8053412 |
| 124 | 2644441169 | 2643221678 | Bacteria | 9540101 |
| 125 | 2644463815 | 2643221682 | Bacteria | 6743283 |
| 126 | 2676488697 | 2675903060 | Bacteria | 10051191 |
| 127 | 2731908441 | 2731639228 | Bacteria | 4187555 |
| 128 | 2738743235 | 2738541281 | Bacteria | 5112672 |
| 129 | 2739352852 | 2738543032 | Bacteria | 5115625 |
| 130 | 2753038961 | 2751185725 | Bacteria | 5740550 |
| 131 | 2753327322 | 2751185792 | Bacteria | 5739090 |
| 132 | 2774381357 | 2773857758 | Bacteria | 3592392 |
| 133 | 2784585888 | 2784132148 | Bacteria | 8627943 |
| 134 | 2799184636 | 2799112218 | Bacteria | 4315149 |
| 135 | 2808846553 | 2808606359 | Bacteria | 9866990 |
| 136 | 2809226589 | 2808606447 | Bacteria | 3572005 |
| 137 | 2809229383 | 2808606448 | Bacteria | 8656184 |
| 138 | 2812483179 | 2811994917 | Bacteria | 7761064 |
| 139 | 2819698743 | 2818991463 | Bacteria | 7948711 |
| 140 | 2829749610 | 2829745981 | Bacteria | 5406054 |
| 141 | 2842700046 | 2842698319 | Bacteria | 5190321 |
| 142 | 2852642479 | 2852635781 | Bacteria | 8251373 |
| 143 | 2856748065 | 2856741275 | Bacteria | 8096094 |
| 144 | 2857722784 | 2857720070 | Bacteria | 3189373 |
| 145 | 2861693663 | 2861691609 | Bacteria | 5628931 |
| 146 | 2862281573 | 2862281513 | Bacteria | 9621493 |
| 147 | 2867437722 | 2867428634 | Bacteria | 9590268 |
| 148 | 2875394931 | 2875391855 | Bacteria | 7600475 |
| 149 | 2889308355 | 2889306138 | Bacteria | 6358934 |
| 150 | 2891399011 | 2891395885 | Bacteria | 9251614 |
| 151 | 2891560189 | 2891554331 | Bacteria | 8812224 |
| 152 | 2891569387 | 2891562705 | Bacteria | 8039471 |
| 153 | 2895438002 | 2895427314 | Bacteria | 13147766 |
| 154 | 2902334640 | 2902330777 | Bacteria | 6395352 |
| 155 | 2902405749 | 2902405164 | Bacteria | 6784948 |
| 156 | 2904509965 | 2904509784 | Bacteria | 3520416 |
| 157 | 2908676443 | 2908674828 | Bacteria | 3382763 |
| 158 | 2908678824 | 2908678064 | Bacteria | 3482747 |
| 159 | 2918501332 | 2918501144 | Bacteria | 8668083 |
| 160 | 2919042585 | 2919042368 | Bacteria | 3905917 |
| 161 | 2919071175 | 2919069694 | Bacteria | 3622919 |
| 162 | 2919394795 | 2919391150 | Bacteria | 4884741 |
| 163 | 2919468952 | 2919468124 | Bacteria | 9133025 |
| 164 | 2920880469 | 2920879853 | Bacteria | 4216831 |
| 165 | 2928125099 | 2928125067 | Bacteria | 5937560 |
| 166 | 2945959109 | 2945956166 | Bacteria | 5110334 |
| 167 | 2946072145 | 2946064051 | Bacteria | 8957905 |
| 168 | 2946079833 | 2946072368 | Bacteria | 8999607 |
| 169 | 2954729503 | 2954721474 | Bacteria | 10456478 |
| 170 | 2954732305 | 2954731030 | Bacteria | 10243860 |
| 171 | 2954748405 | 2954740390 | Bacteria | 10229294 |
| 172 | 2954751249 | 2954749733 | Bacteria | 10366972 |
| 173 | 2954767536 | 2954759201 | Bacteria | 9358192 |
| 174 | 2966600322 | 2966598605 | Bacteria | 7676064 |
| 175 | 2974297993 | 2974294766 | Bacteria | 3767688 |
| 176 | 2974325769 | 2974324384 | Bacteria | 3750535 |
| 177 | 2977230718 | 2977228692 | Bacteria | 3450105 |
| 178 | 2977239519 | 2977236895 | Bacteria | 3569373 |
| 179 | 2977265949 | 2977264416 | Bacteria | 3750737 |
| 180 | 2984546212 | 2984542743 | Bacteria | 3569378 |
| 181 | 2984555135 | 2984551494 | Bacteria | 3877562 |
| 182 | 3003671061 | 3003665799 | Bacteria | 7279786 |
| 183 | 642486740 | 641522639 | Bacteria | 7737025 |
| 184 | 643599391 | 643348564 | Bacteria | 8839022 |
| 185 | 8023627794 | 8023623736 | Bacteria | 8593882 |
| 186 | 8054477434 | 8054472261 | Bacteria | 7464355 |
| 187 | 8056037759 | 8056037122 | Bacteria | 3854319 |
| 188 | Ga0395905_0001237 | |||
| 189 | rootH2_10062616 | |||
| 190 | Ga0070689_100018932 | |||
| 191 | Ga0070700_100000075 | |||
| 192 | Ga0070662_100086979 | |||
| 193 | Ga0070702_100132174 | |||
| 194 | Ga0068859_100165079 | |||
| 195 | Ga0075364_10112338 | |||
| 196 | Ga0097620_100165084 | |||
| 197 | Ga0105239_10348146 | |||
| 198 | Ga0157370_10129630 | |||
| 199 | Ga0157369_10352534 | |||
| 200 | Ga0157379_10226599 | |||
| 201 | Ga0207688_10032647 | |||
| 202 | Ga0207706_10212052 | |||
| 203 | Ga0207640_10072845 | |||
| 204 | Ga0207708_10000097 | |||
| 205 | Ga0307408_100009948 | |||
| 206 | Ga0307405_10077383 | |||
| 207 | Ga0307413_10004553 | |||
| 208 | Ga0307413_10218250 | |||
| 209 | Ga0307410_10014158 | |||
| 210 | Ga0307406_10082309 | |||
| 211 | Ga0307407_10009514 | |||
| 212 | Ga0307412_10043897 | |||
| 213 | Ga0307412_10059515 | |||
| 214 | Ga0307416_100012313 | |||
| 215 | Ga0307416_100070882 | |||
| 216 | Ga0307416_100098107 | |||
| 217 | Ga0307414_10019989 | |||
| 218 | Ga0307411_10012020 | |||
| 219 | Ga0307411_10120405 | |||
| 220 | Ga0307415_100170265 | |||
| 221 | Ga0307415_100388238 | |||
| 222 | Ga0395899_0001272 | |||
| 223 | Ga0395900_0332014 | |||
| 224 | Ga0436364_0440931 | |||
| 225 | Ga0395901_0067976 | |||
| 226 | Ga0451837_0728164 | |||
| 227 | Ga0439433_0016418 | |||
| 228 | Ga0439457_003055 | |||
| 229 | Ga0466972_0016880 | |||
| 230 | Ga0466966_0002207 | |||
| 231 | Ga0466961_0026582 | |||
| 232 | Ga0466961_0056723 | |||
| 233 | Ga0466961_0101419 | |||
| 234 | Ga0466963_0000103 | |||
| 235 | Ga0466963_0000541 | |||
| 236 | Ga0466963_0055604 | |||
| 237 | Ga0466963_0087169 | |||
| 238 | Ga0466963_0102336 | |||
| 239 | Ga0466963_0151740 | |||
| 240 | Ga0466971_0003177 | |||
| 241 | Ga0466971_0008143 | |||
| 242 | Ga0466970_0016768 | |||
| 243 | Ga0466970_0052589 | |||
| 244 | Ga0466970_0070772 | |||
| 245 | Ga0466957_0007854 | |||
| 246 | Ga0466957_0316105 | |||
| 247 | Ga0466960_0007198 | |||
| 248 | Ga0466959_0000245 | |||
| 249 | Ga0466959_0245432 | |||
| 250 | Ga0451576_0008509 | |||
| 251 | Ga0466958_0000070 | |||
| 252 | Ga0466958_0050785 | |||
| 253 | Ga0466958_0072951 | |||
| 254 | Ga0466967_0682117 | |||
| 255 | Ga0495592_0043422 | |||
| 256 | Ga0495629_0062404 | |||
| 257 | Ga0495651_0042125 | |||
| 258 | Ga0495628_0075798 | |||
| 259 | Ga0495640_0014769 | |||
| 260 | Ga0495609_0116938 | |||
| 261 | Ga0495668_0001115 | |||
| 262 | Ga0495657_0045137 | |||
| 263 | Ga0495623_0021216 | |||
| 264 | Ga0495613_0007447 | |||
| 265 | Ga0495604_0023757 | |||
| 266 | Ga0495676_0001746 | |||
| 267 | Ga0495675_0038208 | |||
| 268 | Ga0496120_0108389 | |||
| 269 | Ga0496122_0038055 | |||
| 270 | Ga0496124_0000040 | |||
| 271 | Ga0496124_0037023 | |||
| 272 | Ga0496124_0061551 | |||
| 273 | Ga0501031_0047215 | |||
| 274 | Ga0501032_0061616 | |||
| 275 | Ga0501032_0093961 | |||
| 276 | Ga0501033_0003893 | |||
| 277 | Ga0501033_0009461 | |||
| 278 | Ga0501034_0008001 | |||
| 279 | Ga0501036_0008813 | |||
| 280 | Ga0501036_0023498 | |||
| 281 | Ga0501036_0028086 | |||
| 282 | Ga0501037_0068980 | |||
| 283 | Ga0501038_0013583 | |||
| 284 | Ga0501039_0004318 | |||
| 285 | Ga0501039_0079457 | |||
| 286 | Ga0501042_0004745 | |||
| 287 | Ga0501043_0005075 | |||
| 288 | Ga0501043_0016962 | |||
| 289 | Ga0501043_0018729 | |||
| 290 | Ga0501046_0015718 | |||
| 291 | Ga0501046_0016784 | |||
| 292 | Ga0501047_0045905 | |||
| 293 | Ga0501047_0162145 | |||
| 294 | Ga0501047_0189676 | |||
| 295 | Ga0501068_0091410 | |||
| 296 | Ga0501068_0190064 | |||
| 297 | Ga0501070_0000906 | |||
| 298 | Ga0501070_0031869 | |||
| 299 | Ga0501074_0023822 | |||
| 300 | Ga0501035_0003107 | |||
| 301 | Ga0501035_0393137 | |||
| 302 | Ga0501044_0019659 | |||
| 303 | Ga0501045_0161277 | |||
| 304 | Ga0590071_014063 | |||
| 305 | Ga0466962_0014796 | |||
| 306 | 2545677266 | |||
| 307 | 2547405536 | |||
| 308 | 2554260298 | |||
| 309 | 2596377024 | |||
| 310 | 2643763315 | |||
| 311 | 2644441169 | |||
| 312 | 2644463815 | |||
| 313 | 2676488697 | |||
| 314 | 2731908441 | |||
| 315 | 2738743235 | |||
| 316 | 2739352852 | |||
| 317 | 2753038961 | |||
| 318 | 2753327322 | |||
| 319 | 2774381357 | |||
| 320 | 2784585888 | |||
| 321 | 2799184636 | |||
| 322 | 2808846553 | |||
| 323 | 2809226589 | |||
| 324 | 2809229383 | |||
| 325 | 2812483179 | |||
| 326 | 2819698743 | |||
| 327 | 2829749610 | |||
| 328 | 2842700046 | |||
| 329 | 2852642479 | |||
| 330 | 2856748065 | |||
| 331 | 2857722784 | |||
| 332 | 2861693663 | |||
| 333 | 2862281573 | |||
| 334 | 2867437722 | |||
| 335 | 2875394931 | |||
| 336 | 2889308355 | |||
| 337 | 2891399011 | |||
| 338 | 2891560189 | |||
| 339 | 2891569387 | |||
| 340 | 2895438002 | |||
| 341 | 2902334640 | |||
| 342 | 2902405749 | |||
| 343 | 2904509965 | |||
| 344 | 2908676443 | |||
| 345 | 2908678824 | |||
| 346 | 2918501332 | |||
| 347 | 2919042585 | |||
| 348 | 2919071175 | |||
| 349 | 2919394795 | |||
| 350 | 2919468952 | |||
| 351 | 2920880469 | |||
| 352 | 2928125099 | |||
| 353 | 2945959109 | |||
| 354 | 2946072145 | |||
| 355 | 2946079833 | |||
| 356 | 2954729503 | |||
| 357 | 2954732305 | |||
| 358 | 2954748405 | |||
| 359 | 2954751249 | |||
| 360 | 2954767536 | |||
| 361 | 2966600322 | |||
| 362 | 2974297993 | |||
| 363 | 2974325769 | |||
| 364 | 2977230718 | |||
| 365 | 2977239519 | |||
| 366 | 2977265949 | |||
| 367 | 2984546212 | |||
| 368 | 2984555135 | |||
| 369 | 3003671061 | |||
| 370 | 642486740 | |||
| 371 | 643599391 | |||
| 372 | 8023627794 | |||
| 373 | 8054477434 | |||
| 374 | 8056037759 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rh1-assembly1.cif.gz_A | spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct | 0.9102 | 6 | 355 |
| 4rh1-assembly1.cif.gz_A | spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct | 0.9077 | 6 | 355 |
| 4fhf-assembly1.cif.gz_A | spore photoproduct lyase c140a mutant with dinucleoside spore photoproduct | 0.9011 | 8 | 355 |
| 4fhd-assembly1.cif.gz_A | spore photoproduct lyase complexed with dinucleoside spore photoproduct | 0.9001 | 6 | 355 |
| 4fhg-assembly1.cif.gz_A | spore photoproduct lyase c140s mutant | 0.8993 | 6 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fhcA02 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; | 0.9172 | 121 | 355 | 3.80.30.30 |
| 4fhcA02 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; | 0.9096 | 121 | 355 | 3.80.30.30 |
| 4fhgA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8051 | 8 | 119 | 3.40.50.12110 |
| 4fhgA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7864 | 8 | 119 | 3.40.50.12110 |
| af_Q58214_34_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7392 | 90 | 351 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A147DT53-F1-model_v4 | Radical SAM protein | 0.9962 | 8 | 355 |
GO:0003913
GO:0042601 GO:0051539 GO:1904047 |
| AF-A0A3R8TSV8-F1-model_v4 | Spore photoproduct lyase family protein | 0.9956 | 7 | 355 |
GO:0003913
GO:0042601 GO:0051539 GO:1904047 |
| AF-F3NHS8-F1-model_v4 | Spore photoproduct lyase | 0.9942 | 7 | 355 |
GO:0003913
GO:0042601 GO:0051539 GO:1904047 |
| AF-D5ZX79-F1-model_v4 | Radical SAM domain-containing protein | 0.9937 | 7 | 355 |
GO:0003913
GO:0042601 GO:0051539 GO:1904047 |
| AF-A0A7L7VUZ3-F1-model_v4 | Spore photoproduct lyase family protein | 0.9935 | 7 | 355 |
GO:0003913
GO:0042601 GO:0051539 GO:1904047 |