F288025

General Info

Members Datasets Scaffolds Average Seq Length
187 152 374 366

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0001237|Ga0395905_0001237_7637_8851
Length 404
Sequence MHDDPSGKTLIFTVENDIRIVPATTMQQTSFSFSSSPFSSAPRVLRRSPGLCLPKFNEIYVQQAIERDPEWQARAERILKLFPGAELIPVESHWKIPELRSADPAEWIRSKKSALILGIKSGLKHVTNGRSADFIAASISNGCLSACQYCYVARRKGGSNPLTLFMNIEEIADSIEKHQEKLGPKTEPNSCDPNFWTYDIGCNADLSLDALICDHPGYMIERFAEMRFAKATFATKTVNDEYWLSYDPKGRTRIRYSLMPQAIARFVDIRTSPISVRIQSVNQLVDAGYEVHLNFSPIIIYGGGQWKSDWLALFQEIDQTLTPRAKAQLACEAFFLSHSAEAHELNLQWNPKGEEFLWKPEMQEPKKTKPDVLVYQYALKRRELSWFESTLARELPYCSVRYSF

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
11 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
12 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
13 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
14 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
19 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
20 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
21 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
22 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
23 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
26 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
27 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
28 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
29 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
34 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
35 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
52 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
53 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
54 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
55 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
56 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
57 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
58 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
59 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
60 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
61 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
62 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
84 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
85 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
86 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
87 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
88 2643221548 Streptomyces sp. Root55 Isolate Unclassified
89 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
90 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
91 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
92 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
93 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
94 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
95 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
96 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
97 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
98 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
99 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
100 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
101 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
102 2808606448 Streptomyces sp. 193411 Isolate Unclassified
103 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
104 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
105 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
106 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
107 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
108 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
109 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
110 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
111 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
112 2867428634 Streptomyces sp. RP5T Isolate Unclassified
113 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
114 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
115 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
116 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
117 2891562705 Microbispora tritici MT50 Isolate Unclassified
118 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
119 2902330777 Methylobacterium sp. 2A Isolate Unclassified
120 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
121 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
122 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
123 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
124 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
125 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
126 2919069694 Microbacterium sp. 1154 Isolate Unclassified
127 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
128 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
129 2920879853 Kocuria salina CV6 Isolate Unclassified
130 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
131 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
132 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
133 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
134 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
135 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
136 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
137 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
138 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
139 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
140 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
141 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
142 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
143 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
144 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
145 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
146 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
147 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
148 641522639 Methylobacterium sp. 4-46 Isolate Nodule
149 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
150 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
151 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
152 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.1
Metatranscriptomes 0
Isolates 36.9

Biome Distribution

Category Percentage (%)
Aerial Root 1.07
Bulb 0
Endosphere 0.53
Nodule 1.6
Rhizoplane 0
Rhizosphere 73.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0001237 3300037471 Bacteria 31722
2 rootH2_10062616 3300003320 Bacteria 3622
3 Ga0070689_100018932 3300005340 Bacteria 5083
4 Ga0070700_100000075 3300005441 Bacteria 68207
5 Ga0070662_100086979 3300005457 Bacteria 2339
6 Ga0070702_100132174 3300005615 Bacteria 1578
7 Ga0068859_100165079 3300005617 Bacteria 2294
8 Ga0075364_10112338 3300006051 Bacteria 1819
9 Ga0097620_100165084 3300006931 Bacteria 2294
10 Ga0105239_10348146 3300010375 Bacteria 1673
11 Ga0157370_10129630 3300013104 Bacteria 2353
12 Ga0157369_10352534 3300013105 Bacteria 1528
13 Ga0157379_10226599 3300014968 Bacteria 1694
14 Ga0207688_10032647 3300025901 Bacteria 2878
15 Ga0207706_10212052 3300025933 Bacteria 1697
16 Ga0207640_10072845 3300025981 Bacteria 2319
17 Ga0207708_10000097 3300026075 Bacteria 67533
18 Ga0307408_100009948 3300031548 Bacteria 6264
19 Ga0307405_10077383 3300031731 Bacteria 2161
20 Ga0307413_10004553 3300031824 Bacteria 6050
21 Ga0307413_10218250 3300031824 Bacteria 1391
22 Ga0307410_10014158 3300031852 Bacteria 4682
23 Ga0307406_10082309 3300031901 Bacteria 2143
24 Ga0307407_10009514 3300031903 Bacteria 4531
25 Ga0307412_10043897 3300031911 Bacteria 2914
26 Ga0307412_10059515 3300031911 Bacteria 2560
27 Ga0307416_100012313 3300032002 Bacteria 5757
28 Ga0307416_100070882 3300032002 Bacteria 2892
29 Ga0307416_100098107 3300032002 Bacteria 2540
30 Ga0307414_10019989 3300032004 Bacteria 4163
31 Ga0307411_10012020 3300032005 Bacteria 4702
32 Ga0307411_10120405 3300032005 Bacteria 1898
33 Ga0307415_100170265 3300032126 Bacteria 1698
34 Ga0307415_100388238 3300032126 Bacteria 1188
35 Ga0395899_0001272 3300037312 Bacteria 21924
36 Ga0395900_0332014 3300037418 Bacteria 1498
37 Ga0436364_0440931 3300037853 Bacteria 3072
38 Ga0395901_0067976 3300038443 Bacteria 3712
39 Ga0451837_0728164 3300041494 Bacteria 2606
40 Ga0439433_0016418 3300041999 Bacteria 1640
41 Ga0439457_003055 3300042014 Bacteria 4631
42 Ga0466972_0016880 3300044658 Bacteria 3651
43 Ga0466966_0002207 3300044684 Bacteria 12654
44 Ga0466961_0026582 3300044693 Bacteria 3720
45 Ga0466961_0056723 3300044693 Bacteria 2496
46 Ga0466961_0101419 3300044693 Bacteria 1813
47 Ga0466963_0000103 3300044694 Bacteria 30319
48 Ga0466963_0000541 3300044694 Bacteria 17780
49 Ga0466963_0055604 3300044694 Bacteria 2632
50 Ga0466963_0087169 3300044694 Bacteria 2122
51 Ga0466963_0102336 3300044694 Bacteria 1962
52 Ga0466963_0151740 3300044694 Bacteria 1609
53 Ga0466971_0003177 3300044719 Bacteria 7009
54 Ga0466971_0008143 3300044719 Bacteria 4570
55 Ga0466970_0016768 3300044765 Bacteria 3780
56 Ga0466970_0052589 3300044765 Bacteria 2174
57 Ga0466970_0070772 3300044765 Bacteria 1876
58 Ga0466957_0007854 3300044842 Bacteria 6047
59 Ga0466957_0316105 3300044842 Bacteria 1052
60 Ga0466960_0007198 3300044901 Bacteria 4505
61 Ga0466959_0000245 3300045049 Bacteria 33869
62 Ga0466959_0245432 3300045049 Bacteria 1236
63 Ga0451576_0008509 3300045051 Bacteria 12036
64 Ga0466958_0000070 3300045836 Bacteria 30511
65 Ga0466958_0050785 3300045836 Bacteria 2510
66 Ga0466958_0072951 3300045836 Bacteria 2102
67 Ga0466967_0682117 3300045976 Bacteria 1017
68 Ga0495592_0043422 3300046454 Bacteria 3363
69 Ga0495629_0062404 3300046459 Bacteria 2603
70 Ga0495651_0042125 3300046462 Bacteria 3546
71 Ga0495628_0075798 3300046516 Bacteria 2619
72 Ga0495640_0014769 3300046533 Bacteria 5898
73 Ga0495609_0116938 3300046538 Bacteria 1148
74 Ga0495668_0001115 3300046616 Bacteria 27695
75 Ga0495657_0045137 3300046675 Bacteria 2992
76 Ga0495623_0021216 3300046679 Bacteria 4196
77 Ga0495613_0007447 3300046689 Bacteria 8158
78 Ga0495604_0023757 3300047317 Bacteria 4892
79 Ga0495676_0001746 3300047321 Bacteria 18981
80 Ga0495675_0038208 3300047444 Bacteria 3056
81 Ga0496120_0108389 3300048923 Bacteria 1455
82 Ga0496122_0038055 3300048925 Bacteria 3861
83 Ga0496124_0000040 3300048927 Bacteria 307061
84 Ga0496124_0037023 3300048927 Bacteria 4247
85 Ga0496124_0061551 3300048927 Bacteria 3146
86 Ga0501031_0047215 3300049568 Bacteria 2807
87 Ga0501032_0061616 3300049569 Bacteria 2514
88 Ga0501032_0093961 3300049569 Bacteria 1988
89 Ga0501033_0003893 3300049570 Bacteria 12134
90 Ga0501033_0009461 3300049570 Bacteria 7504
91 Ga0501034_0008001 3300049571 Bacteria 11220
92 Ga0501036_0008813 3300049572 Bacteria 8280
93 Ga0501036_0023498 3300049572 Bacteria 5193
94 Ga0501036_0028086 3300049572 Bacteria 4756
95 Ga0501037_0068980 3300049573 Bacteria 2574
96 Ga0501038_0013583 3300049574 Bacteria 7420
97 Ga0501039_0004318 3300049575 Bacteria 10718
98 Ga0501039_0079457 3300049575 Bacteria 2552
99 Ga0501042_0004745 3300049578 Bacteria 8677
100 Ga0501043_0005075 3300049579 Bacteria 10652
101 Ga0501043_0016962 3300049579 Bacteria 5708
102 Ga0501043_0018729 3300049579 Bacteria 5431
103 Ga0501046_0015718 3300049580 Bacteria 6352
104 Ga0501046_0016784 3300049580 Bacteria 6121
105 Ga0501047_0045905 3300049581 Bacteria 4223
106 Ga0501047_0162145 3300049581 Bacteria 2107
107 Ga0501047_0189676 3300049581 Bacteria 1919
108 Ga0501068_0091410 3300049584 Bacteria 1878
109 Ga0501068_0190064 3300049584 Bacteria 1300
110 Ga0501070_0000906 3300049586 Bacteria 27001
111 Ga0501070_0031869 3300049586 Bacteria 4415
112 Ga0501074_0023822 3300049590 Bacteria 4450
113 Ga0501035_0003107 3300049822 Bacteria 15953
114 Ga0501035_0393137 3300049822 Bacteria 1154
115 Ga0501044_0019659 3300049823 Bacteria 7220
116 Ga0501045_0161277 3300049824 Bacteria 1669
117 Ga0590071_014063 3300059421 Bacteria 1875
118 Ga0466962_0014796 3300061719 Bacteria 3759
119 2545677266 2545555834 Bacteria 8130841
120 2547405536 2547132111 Bacteria 8013147
121 2554260298 2554235005 Bacteria 6457341
122 2596377024 2595698237 Bacteria 6712432
123 2643763315 2643221548 Bacteria 8053412
124 2644441169 2643221678 Bacteria 9540101
125 2644463815 2643221682 Bacteria 6743283
126 2676488697 2675903060 Bacteria 10051191
127 2731908441 2731639228 Bacteria 4187555
128 2738743235 2738541281 Bacteria 5112672
129 2739352852 2738543032 Bacteria 5115625
130 2753038961 2751185725 Bacteria 5740550
131 2753327322 2751185792 Bacteria 5739090
132 2774381357 2773857758 Bacteria 3592392
133 2784585888 2784132148 Bacteria 8627943
134 2799184636 2799112218 Bacteria 4315149
135 2808846553 2808606359 Bacteria 9866990
136 2809226589 2808606447 Bacteria 3572005
137 2809229383 2808606448 Bacteria 8656184
138 2812483179 2811994917 Bacteria 7761064
139 2819698743 2818991463 Bacteria 7948711
140 2829749610 2829745981 Bacteria 5406054
141 2842700046 2842698319 Bacteria 5190321
142 2852642479 2852635781 Bacteria 8251373
143 2856748065 2856741275 Bacteria 8096094
144 2857722784 2857720070 Bacteria 3189373
145 2861693663 2861691609 Bacteria 5628931
146 2862281573 2862281513 Bacteria 9621493
147 2867437722 2867428634 Bacteria 9590268
148 2875394931 2875391855 Bacteria 7600475
149 2889308355 2889306138 Bacteria 6358934
150 2891399011 2891395885 Bacteria 9251614
151 2891560189 2891554331 Bacteria 8812224
152 2891569387 2891562705 Bacteria 8039471
153 2895438002 2895427314 Bacteria 13147766
154 2902334640 2902330777 Bacteria 6395352
155 2902405749 2902405164 Bacteria 6784948
156 2904509965 2904509784 Bacteria 3520416
157 2908676443 2908674828 Bacteria 3382763
158 2908678824 2908678064 Bacteria 3482747
159 2918501332 2918501144 Bacteria 8668083
160 2919042585 2919042368 Bacteria 3905917
161 2919071175 2919069694 Bacteria 3622919
162 2919394795 2919391150 Bacteria 4884741
163 2919468952 2919468124 Bacteria 9133025
164 2920880469 2920879853 Bacteria 4216831
165 2928125099 2928125067 Bacteria 5937560
166 2945959109 2945956166 Bacteria 5110334
167 2946072145 2946064051 Bacteria 8957905
168 2946079833 2946072368 Bacteria 8999607
169 2954729503 2954721474 Bacteria 10456478
170 2954732305 2954731030 Bacteria 10243860
171 2954748405 2954740390 Bacteria 10229294
172 2954751249 2954749733 Bacteria 10366972
173 2954767536 2954759201 Bacteria 9358192
174 2966600322 2966598605 Bacteria 7676064
175 2974297993 2974294766 Bacteria 3767688
176 2974325769 2974324384 Bacteria 3750535
177 2977230718 2977228692 Bacteria 3450105
178 2977239519 2977236895 Bacteria 3569373
179 2977265949 2977264416 Bacteria 3750737
180 2984546212 2984542743 Bacteria 3569378
181 2984555135 2984551494 Bacteria 3877562
182 3003671061 3003665799 Bacteria 7279786
183 642486740 641522639 Bacteria 7737025
184 643599391 643348564 Bacteria 8839022
185 8023627794 8023623736 Bacteria 8593882
186 8054477434 8054472261 Bacteria 7464355
187 8056037759 8056037122 Bacteria 3854319
188 Ga0395905_0001237
189 rootH2_10062616
190 Ga0070689_100018932
191 Ga0070700_100000075
192 Ga0070662_100086979
193 Ga0070702_100132174
194 Ga0068859_100165079
195 Ga0075364_10112338
196 Ga0097620_100165084
197 Ga0105239_10348146
198 Ga0157370_10129630
199 Ga0157369_10352534
200 Ga0157379_10226599
201 Ga0207688_10032647
202 Ga0207706_10212052
203 Ga0207640_10072845
204 Ga0207708_10000097
205 Ga0307408_100009948
206 Ga0307405_10077383
207 Ga0307413_10004553
208 Ga0307413_10218250
209 Ga0307410_10014158
210 Ga0307406_10082309
211 Ga0307407_10009514
212 Ga0307412_10043897
213 Ga0307412_10059515
214 Ga0307416_100012313
215 Ga0307416_100070882
216 Ga0307416_100098107
217 Ga0307414_10019989
218 Ga0307411_10012020
219 Ga0307411_10120405
220 Ga0307415_100170265
221 Ga0307415_100388238
222 Ga0395899_0001272
223 Ga0395900_0332014
224 Ga0436364_0440931
225 Ga0395901_0067976
226 Ga0451837_0728164
227 Ga0439433_0016418
228 Ga0439457_003055
229 Ga0466972_0016880
230 Ga0466966_0002207
231 Ga0466961_0026582
232 Ga0466961_0056723
233 Ga0466961_0101419
234 Ga0466963_0000103
235 Ga0466963_0000541
236 Ga0466963_0055604
237 Ga0466963_0087169
238 Ga0466963_0102336
239 Ga0466963_0151740
240 Ga0466971_0003177
241 Ga0466971_0008143
242 Ga0466970_0016768
243 Ga0466970_0052589
244 Ga0466970_0070772
245 Ga0466957_0007854
246 Ga0466957_0316105
247 Ga0466960_0007198
248 Ga0466959_0000245
249 Ga0466959_0245432
250 Ga0451576_0008509
251 Ga0466958_0000070
252 Ga0466958_0050785
253 Ga0466958_0072951
254 Ga0466967_0682117
255 Ga0495592_0043422
256 Ga0495629_0062404
257 Ga0495651_0042125
258 Ga0495628_0075798
259 Ga0495640_0014769
260 Ga0495609_0116938
261 Ga0495668_0001115
262 Ga0495657_0045137
263 Ga0495623_0021216
264 Ga0495613_0007447
265 Ga0495604_0023757
266 Ga0495676_0001746
267 Ga0495675_0038208
268 Ga0496120_0108389
269 Ga0496122_0038055
270 Ga0496124_0000040
271 Ga0496124_0037023
272 Ga0496124_0061551
273 Ga0501031_0047215
274 Ga0501032_0061616
275 Ga0501032_0093961
276 Ga0501033_0003893
277 Ga0501033_0009461
278 Ga0501034_0008001
279 Ga0501036_0008813
280 Ga0501036_0023498
281 Ga0501036_0028086
282 Ga0501037_0068980
283 Ga0501038_0013583
284 Ga0501039_0004318
285 Ga0501039_0079457
286 Ga0501042_0004745
287 Ga0501043_0005075
288 Ga0501043_0016962
289 Ga0501043_0018729
290 Ga0501046_0015718
291 Ga0501046_0016784
292 Ga0501047_0045905
293 Ga0501047_0162145
294 Ga0501047_0189676
295 Ga0501068_0091410
296 Ga0501068_0190064
297 Ga0501070_0000906
298 Ga0501070_0031869
299 Ga0501074_0023822
300 Ga0501035_0003107
301 Ga0501035_0393137
302 Ga0501044_0019659
303 Ga0501045_0161277
304 Ga0590071_014063
305 Ga0466962_0014796
306 2545677266
307 2547405536
308 2554260298
309 2596377024
310 2643763315
311 2644441169
312 2644463815
313 2676488697
314 2731908441
315 2738743235
316 2739352852
317 2753038961
318 2753327322
319 2774381357
320 2784585888
321 2799184636
322 2808846553
323 2809226589
324 2809229383
325 2812483179
326 2819698743
327 2829749610
328 2842700046
329 2852642479
330 2856748065
331 2857722784
332 2861693663
333 2862281573
334 2867437722
335 2875394931
336 2889308355
337 2891399011
338 2891560189
339 2891569387
340 2895438002
341 2902334640
342 2902405749
343 2904509965
344 2908676443
345 2908678824
346 2918501332
347 2919042585
348 2919071175
349 2919394795
350 2919468952
351 2920880469
352 2928125099
353 2945959109
354 2946072145
355 2946079833
356 2954729503
357 2954732305
358 2954748405
359 2954751249
360 2954767536
361 2966600322
362 2974297993
363 2974325769
364 2977230718
365 2977239519
366 2977265949
367 2984546212
368 2984555135
369 3003671061
370 642486740
371 643599391
372 8023627794
373 8054477434
374 8056037759

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20903

SPL

Spore photoproduct lyase

62

402

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rh1-assembly1.cif.gz_A spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct 0.9102 6 355
4rh1-assembly1.cif.gz_A spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct 0.9077 6 355
4fhf-assembly1.cif.gz_A spore photoproduct lyase c140a mutant with dinucleoside spore photoproduct 0.9011 8 355
4fhd-assembly1.cif.gz_A spore photoproduct lyase complexed with dinucleoside spore photoproduct 0.9001 6 355
4fhg-assembly1.cif.gz_A spore photoproduct lyase c140s mutant 0.8993 6 355
ID Description Score Start End Superfamily
4fhcA02 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.9172 121 355 3.80.30.30
4fhcA02 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.9096 121 355 3.80.30.30
4fhgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8051 8 119 3.40.50.12110
4fhgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7864 8 119 3.40.50.12110
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7392 90 351 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A147DT53-F1-model_v4 Radical SAM protein 0.9962 8 355 GO:0003913
GO:0042601
GO:0051539
GO:1904047
AF-A0A3R8TSV8-F1-model_v4 Spore photoproduct lyase family protein 0.9956 7 355 GO:0003913
GO:0042601
GO:0051539
GO:1904047
AF-F3NHS8-F1-model_v4 Spore photoproduct lyase 0.9942 7 355 GO:0003913
GO:0042601
GO:0051539
GO:1904047
AF-D5ZX79-F1-model_v4 Radical SAM domain-containing protein 0.9937 7 355 GO:0003913
GO:0042601
GO:0051539
GO:1904047
AF-A0A7L7VUZ3-F1-model_v4 Spore photoproduct lyase family protein 0.9935 7 355 GO:0003913
GO:0042601
GO:0051539
GO:1904047

Map