F288017

General Info

Members Datasets Scaffolds Average Seq Length
187 127 187 212

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0002226|Ga0395898_0002226_19283_19972
Length 229
Sequence VAPAHEEEGRHVAPMIDVRAFTVGPIQENCYFVRRPQAAGAVVVDPGEEAPRLLEALDSLGIESVEAILLTHCHFDHVGAVKEIHDATGAPVWCPVLETALLADIDAYTFPGFGPFESYDADHTVSGGEELELAGLTFDVRFTPGHSPGHVTYAVRGEDVLLSGDVLFEGSIGRTDLPGGDLSTLLASIESLLDEFPPHTRVHPGHGRVTTLGDEQATNPFLRELAHHA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 0
Rhizoplane 7.49
Rhizosphere 77.54
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10063855 3300003203 Bacteria 1179
2 Ga0070666_10031716 3300005335 Bacteria 3489
3 Ga0070682_100450176 3300005337 Bacteria 986
4 Ga0068868_100022420 3300005338 Bacteria 4765
5 Ga0070674_100151063 3300005356 Bacteria 1753
6 Ga0070700_100127472 3300005441 Bacteria 1713
7 Ga0070663_100064729 3300005455 Bacteria 2643
8 Ga0070695_100285048 3300005545 Unclassified 1215
9 Ga0070693_100456263 3300005547 Bacteria 898
10 Ga0070665_100003122 3300005548 Bacteria 17846
11 Ga0070665_100008785 3300005548 Bacteria 10223
12 Ga0070704_100248313 3300005549 Bacteria 1460
13 Ga0070704_100856844 3300005549 Bacteria 815
14 Ga0070664_100136702 3300005564 Bacteria 2156
15 Ga0068856_100267945 3300005614 Bacteria 1724
16 Ga0068856_100409336 3300005614 Bacteria 1376
17 Ga0068859_100160135 3300005617 Bacteria 2330
18 Ga0068864_100209809 3300005618 Bacteria 1793
19 Ga0068861_100019976 3300005719 Bacteria 4790
20 Ga0068851_10283681 3300005834 Bacteria 948
21 Ga0081455_10096811 3300005937 Bacteria 2379
22 Ga0081538_10000189 3300005981 Bacteria 67621
23 Ga0081538_10050876 3300005981 Bacteria 2495
24 Ga0081539_10068298 3300005985 Bacteria 1918
25 Ga0070717_10078868 3300006028 Bacteria 2760
26 Ga0070717_10079142 3300006028 Bacteria 2756
27 Ga0075365_10000891 3300006038 Bacteria 12493
28 Ga0075365_10008725 3300006038 Bacteria 5778
29 Ga0075365_10013106 3300006038 Bacteria 4944
30 Ga0075365_10014973 3300006038 Bacteria 4678
31 Ga0075365_10131203 3300006038 Bacteria 1734
32 Ga0075365_10201667 3300006038 Bacteria 1393
33 Ga0075365_10458691 3300006038 Bacteria 900
34 Ga0075364_10083708 3300006051 Bacteria 2112
35 Ga0075364_10098472 3300006051 Bacteria 1945
36 Ga0075364_10153390 3300006051 Bacteria 1553
37 Ga0075364_10160222 3300006051 Bacteria 1519
38 Ga0075364_10333065 3300006051 Bacteria 1034
39 Ga0075367_10367166 3300006178 Bacteria 909
40 Ga0075370_10099407 3300006353 Bacteria 1683
41 Ga0075428_100089277 3300006844 Bacteria 3362
42 Ga0075431_100018967 3300006847 Bacteria 7007
43 Ga0075431_100032119 3300006847 Bacteria 5409
44 Ga0075433_10066444 3300006852 Bacteria 3164
45 Ga0075433_10069124 3300006852 Bacteria 3101
46 Ga0075434_100019085 3300006871 Bacteria 6626
47 Ga0075434_100025859 3300006871 Bacteria 5745
48 Ga0097620_100160124 3300006931 Bacteria 2330
49 Ga0105240_10499158 3300009093 Bacteria 1353
50 Ga0105245_10150235 3300009098 Bacteria 2202
51 Ga0105245_10484933 3300009098 Bacteria 1250
52 Ga0105247_10250710 3300009101 Bacteria 1210
53 Ga0114129_10103369 3300009147 Bacteria 3939
54 Ga0114129_10441014 3300009147 Bacteria 1709
55 Ga0105243_10049140 3300009148 Bacteria 3327
56 Ga0105243_10111150 3300009148 Bacteria 2293
57 Ga0105249_10071453 3300009553 Bacteria 3206
58 Ga0105249_10102837 3300009553 Bacteria 2690
59 Ga0105239_10315139 3300010375 Bacteria 1763
60 Ga0105246_10227478 3300011119 Bacteria 1466
61 Ga0163163_10330248 3300014325 Bacteria 1579
62 Ga0182008_10046718 3300014497 Bacteria 2152
63 Ga0206350_10204485 3300020080 Bacteria 852
64 Ga0213876_10149753 3300021384 Bacteria 1241
65 Ga0213875_10047198 3300021388 Bacteria 2020
66 Ga0207642_10021296 3300025899 Bacteria 2550
67 Ga0207710_10226656 3300025900 Bacteria 929
68 Ga0207680_10036278 3300025903 Bacteria 2839
69 Ga0207687_10051819 3300025927 Bacteria 2862
70 Ga0207700_10000384 3300025928 Bacteria 25706
71 Ga0207664_10089430 3300025929 Bacteria 2521
72 Ga0207664_10318618 3300025929 Bacteria 1372
73 Ga0207709_10071224 3300025935 Bacteria 2207
74 Ga0207669_10038294 3300025937 Bacteria 2760
75 Ga0207679_10117146 3300025945 Bacteria 2113
76 Ga0207679_10628097 3300025945 Bacteria 970
77 Ga0207679_10986978 3300025945 Bacteria 772
78 Ga0207712_10057682 3300025961 Bacteria 2740
79 Ga0207712_10093682 3300025961 Bacteria 2217
80 Ga0207677_10000379 3300026023 Bacteria 30693
81 Ga0207678_10120806 3300026067 Bacteria 2236
82 Ga0207708_10091608 3300026075 Bacteria 2344
83 Ga0207648_10064875 3300026089 Bacteria 3183
84 Ga0207676_10401571 3300026095 Bacteria 1281
85 Ga0207675_100059559 3300026118 Bacteria 3563
86 Ga0268266_10000376 3300028379 Bacteria 68245
87 Ga0268266_10337202 3300028379 Bacteria 1414
88 Ga0316576_10021613 3300031727 Bacteria 4454
89 Ga0307405_10415166 3300031731 Bacteria 1057
90 Ga0307413_10024389 3300031824 Bacteria 3297
91 Ga0307410_10008387 3300031852 Bacteria 5726
92 Ga0307410_10208872 3300031852 Bacteria 1495
93 Ga0307406_10006639 3300031901 Bacteria 6394
94 Ga0307407_10034584 3300031903 Bacteria 2768
95 Ga0307407_10730608 3300031903 Bacteria 748
96 Ga0307409_100010616 3300031995 Bacteria 5741
97 Ga0307416_100263478 3300032002 Bacteria 1686
98 Ga0307416_100264190 3300032002 Bacteria 1684
99 Ga0307414_10130312 3300032004 Bacteria 1951
100 Ga0307411_10106299 3300032005 Bacteria 1997
101 Ga0307415_100002014 3300032126 Bacteria 10007
102 Ga0316574_0032030 3300035398 Bacteria 3193
103 Ga0316584_0002367 3300036712 Bacteria 11908
104 Ga0395900_0018848 3300037418 Bacteria 7038
105 Ga0395900_0036847 3300037418 Bacteria 5041
106 Ga0395900_0197026 3300037418 Bacteria 2040
107 Ga0395898_0002226 3300037466 Bacteria 23614
108 Ga0395898_0008997 3300037466 Bacteria 10511
109 Ga0395905_0005751 3300037471 Bacteria 12605
110 Ga0436364_1454144 3300037853 Bacteria 9318
111 Ga0395901_0010229 3300038443 Bacteria 9503
112 Ga0395901_0162142 3300038443 Bacteria 2348
113 Ga0436365_1718243 3300039437 Bacteria 2970
114 Ga0466969_0006715 3300044656 Bacteria 6118
115 Ga0466966_0131414 3300044684 Bacteria 1533
116 Ga0466959_0045537 3300045049 Bacteria 3230
117 Ga0466959_0270936 3300045049 Bacteria 1167
118 Ga0466967_0002279 3300045976 Bacteria 11844
119 Ga0466967_0361699 3300045976 Bacteria 1406
120 Ga0495629_0000106 3300046459 Bacteria 74178
121 Ga0495640_0020566 3300046533 Bacteria 4856
122 Ga0495587_0002896 3300046536 Bacteria 11489
123 Ga0495598_0039023 3300046537 Bacteria 1379
124 Ga0495645_0001115 3300046543 Bacteria 18177
125 Ga0495647_0008965 3300046681 Bacteria 3373
126 Ga0495674_0000010 3300047319 Bacteria 285794
127 Ga0495674_0479601 3300047319 Unclassified 997
128 Ga0495676_0000186 3300047321 Bacteria 49054
129 Ga0495675_0009985 3300047444 Bacteria 5921
130 Ga0496100_0000001 3300048903 Bacteria 530179
131 Ga0496101_0000004 3300048904 Bacteria 331599
132 Ga0496102_0411541 3300048905 Bacteria 1271
133 Ga0496103_0136769 3300048906 Bacteria 1566
134 Ga0496106_0000056 3300048909 Bacteria 90682
135 Ga0496106_0101217 3300048909 Bacteria 2235
136 Ga0496106_0109006 3300048909 Bacteria 2154
137 Ga0496107_0000005 3300048910 Bacteria 281747
138 Ga0496107_0017511 3300048910 Bacteria 5040
139 Ga0496108_0106758 3300048911 Bacteria 2391
140 Ga0496108_0246081 3300048911 Bacteria 1555
141 Ga0496109_0000056 3300048912 Bacteria 120835
142 Ga0496109_0635783 3300048912 Bacteria 1004
143 Ga0496111_0296080 3300048914 Bacteria 1200
144 Ga0501031_0254652 3300049568 Bacteria 1141
145 Ga0501032_0187825 3300049569 Bacteria 1351
146 Ga0501033_0207469 3300049570 Bacteria 1398
147 Ga0501034_0015320 3300049571 Bacteria 7880
148 Ga0501034_0038680 3300049571 Bacteria 4831
149 Ga0501034_0204846 3300049571 Bacteria 1929
150 Ga0501034_0263962 3300049571 Bacteria 1664
151 Ga0501036_0087108 3300049572 Bacteria 2640
152 Ga0501036_0358701 3300049572 Bacteria 1217
153 Ga0501039_0050666 3300049575 Bacteria 3213
154 Ga0501042_0168441 3300049578 Bacteria 1581
155 Ga0501046_0518896 3300049580 Bacteria 852
156 Ga0501068_0232225 3300049584 Bacteria 1173
157 Ga0501072_0031700 3300049588 Bacteria 4140
158 Ga0501072_0096022 3300049588 Bacteria 2356
159 Ga0501079_0123620 3300049741 Bacteria 2013
160 Ga0501045_0228128 3300049824 Bacteria 1386
161 Ga0501045_0341804 3300049824 Bacteria 1114
162 nmdc:mga00v17_19119_c1 3300050491 Bacteria 3904
163 nmdc:mga00v17_285162_c1 3300050491 Bacteria 1072
164 nmdc:mga00v17_29986_c1 3300050491 Bacteria 3196
165 nmdc:mga0yw44_156833_c1 3300050492 Bacteria 1488
166 nmdc:mga0yw44_261114_c1 3300050492 Bacteria 1154
167 nmdc:mga0yw44_3344_c1 3300050492 Bacteria 7106
168 nmdc:mga0yw44_6701_c1 3300050492 Bacteria 5593
169 nmdc:mga0yw44_8316_c1 3300050492 Bacteria 5159
170 nmdc:mga06z11_357892_c1 3300050494 Bacteria 874
171 nmdc:mga06z11_476681_c1 3300050494 Bacteria 755
172 nmdc:mga05p37_170472_c1 3300050507 Bacteria 2654
173 nmdc:mga05p37_258552_c1 3300050507 Bacteria 2085
174 nmdc:mga05p37_498488_c1 3300050507 Bacteria 1398
175 nmdc:mga06r32_10710_c1 3300050510 Bacteria 8263
176 nmdc:mga0n895_85047_c1 3300050512 Bacteria 3157
177 nmdc:mga0n895_8684_c1 3300050512 Bacteria 8823
178 nmdc:mga08x19_286596_c1 3300050514 Unclassified 1142
179 nmdc:mga0a205_192171_c1 3300050515 Unclassified 1933
180 nmdc:mga0a205_298632_c1 3300050515 Bacteria 1484
181 Ga0495612_0030921 3300053078 Bacteria 2158
182 Ga0495655_0030292 3300053083 Bacteria 1308
183 Ga0495619_0003472 3300053085 Bacteria 10170
184 Ga0495619_0009466 3300053085 Bacteria 6145
185 Ga0501084_0366846 3300054114 Bacteria 1217
186 Ga0501082_0369081 3300060353 Bacteria 1252
187 Ga0466962_0060274 3300061719 Bacteria 1811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0635783 Ga0496109_0635783_435_992 185
2 3300005981 Ga0081538_10050876 Ga0081538_100508762 196
3 3300025945 Ga0207679_10628097 Ga0207679_106280971 205
4 3300005981 Ga0081538_10000189 Ga0081538_1000018910 208
5 3300047321 Ga0495676_0000186 Ga0495676_0000186_14774_15400 208
6 3300048903 Ga0496100_0000001 Ga0496100_0000001_293552_294178 208
7 3300048904 Ga0496101_0000004 Ga0496101_0000004_94904_95530 208
8 3300048909 Ga0496106_0000056 Ga0496106_0000056_15877_16503 208
9 3300048910 Ga0496107_0000005 Ga0496107_0000005_236070_236696 208
10 3300053085 Ga0495619_0009466 Ga0495619_0009466_1963_2589 208
11 3300006028 Ga0070717_10078868 Ga0070717_100788683 209
12 3300020080 Ga0206350_10204485 Ga0206350_102044852 209
13 3300025929 Ga0207664_10318618 Ga0207664_103186182 209
14 3300045976 Ga0466967_0361699 Ga0466967_0361699_275_907 209
15 3300047319 Ga0495674_0479601 Ga0495674_0479601_179_814 209
16 3300005455 Ga0070663_100064729 Ga0070663_1000647292 210
17 3300005548 Ga0070665_100008785 Ga0070665_1000087856 210
18 3300005564 Ga0070664_100136702 Ga0070664_1001367022 210
19 3300025945 Ga0207679_10117146 Ga0207679_101171462 210
20 3300026067 Ga0207678_10120806 Ga0207678_101208062 210
21 3300028379 Ga0268266_10337202 Ga0268266_103372022 210
22 3300005337 Ga0070682_100450176 Ga0070682_1004501762 211
23 3300005338 Ga0068868_100022420 Ga0068868_1000224204 211
24 3300005356 Ga0070674_100151063 Ga0070674_1001510633 211
25 3300005441 Ga0070700_100127472 Ga0070700_1001274722 211
26 3300005547 Ga0070693_100456263 Ga0070693_1004562631 211
27 3300005549 Ga0070704_100248313 Ga0070704_1002483131 211
28 3300005614 Ga0068856_100409336 Ga0068856_1004093362 211
29 3300005617 Ga0068859_100160135 Ga0068859_1001601353 211
30 3300005618 Ga0068864_100209809 Ga0068864_1002098093 211
31 3300005719 Ga0068861_100019976 Ga0068861_1000199763 211
32 3300005834 Ga0068851_10283681 Ga0068851_102836811 211
33 3300006038 Ga0075365_10014973 Ga0075365_100149735 211
34 3300006931 Ga0097620_100160124 Ga0097620_1001601242 211
35 3300009098 Ga0105245_10150235 Ga0105245_101502353 211
36 3300009101 Ga0105247_10250710 Ga0105247_102507102 211
37 3300009148 Ga0105243_10049140 Ga0105243_100491402 211
38 3300009553 Ga0105249_10102837 Ga0105249_101028374 211
39 3300010375 Ga0105239_10315139 Ga0105239_103151393 211
40 3300011119 Ga0105246_10227478 Ga0105246_102274782 211
41 3300014325 Ga0163163_10330248 Ga0163163_103302482 211
42 3300014497 Ga0182008_10046718 Ga0182008_100467183 211
43 3300025899 Ga0207642_10021296 Ga0207642_100212963 211
44 3300025900 Ga0207710_10226656 Ga0207710_102266561 211
45 3300025927 Ga0207687_10051819 Ga0207687_100518192 211
46 3300025935 Ga0207709_10071224 Ga0207709_100712242 211
47 3300025937 Ga0207669_10038294 Ga0207669_100382944 211
48 3300025945 Ga0207679_10986978 Ga0207679_109869782 211
49 3300025961 Ga0207712_10057682 Ga0207712_100576823 211
50 3300026075 Ga0207708_10091608 Ga0207708_100916082 211
51 3300026089 Ga0207648_10064875 Ga0207648_100648752 211
52 3300026095 Ga0207676_10401571 Ga0207676_104015713 211
53 3300026118 Ga0207675_100059559 Ga0207675_1000595593 211
54 3300031731 Ga0307405_10415166 Ga0307405_104151662 211
55 3300031824 Ga0307413_10024389 Ga0307413_100243894 211
56 3300031852 Ga0307410_10008387 Ga0307410_100083873 211
57 3300031852 Ga0307410_10208872 Ga0307410_102088723 211
58 3300031901 Ga0307406_10006639 Ga0307406_100066392 211
59 3300031903 Ga0307407_10034584 Ga0307407_100345843 211
60 3300031903 Ga0307407_10730608 Ga0307407_107306081 211
61 3300031995 Ga0307409_100010616 Ga0307409_1000106162 211
62 3300032002 Ga0307416_100263478 Ga0307416_1002634783 211
63 3300032002 Ga0307416_100264190 Ga0307416_1002641902 211
64 3300032004 Ga0307414_10130312 Ga0307414_101303123 211
65 3300032005 Ga0307411_10106299 Ga0307411_101062992 211
66 3300032126 Ga0307415_100002014 Ga0307415_1000020144 211
67 3300048909 Ga0496106_0109006 Ga0496106_0109006_287_922 211
68 3300048911 Ga0496108_0106758 Ga0496108_0106758_1520_2155 211
69 3300048914 Ga0496111_0296080 Ga0496111_0296080_22_657 211
70 3300050492 nmdc:mga0yw44_6701_c1 nmdc:mga0yw44_6701_c1_373_1008 211
71 3300005545 Ga0070695_100285048 Ga0070695_1002850482 212
72 3300005549 Ga0070704_100856844 Ga0070704_1008568441 212
73 3300005937 Ga0081455_10096811 Ga0081455_100968112 212
74 3300006038 Ga0075365_10000891 Ga0075365_100008919 212
75 3300006038 Ga0075365_10008725 Ga0075365_100087253 212
76 3300006038 Ga0075365_10458691 Ga0075365_104586912 212
77 3300006051 Ga0075364_10160222 Ga0075364_101602223 212
78 3300006051 Ga0075364_10333065 Ga0075364_103330652 212
79 3300006844 Ga0075428_100089277 Ga0075428_1000892772 212
80 3300006847 Ga0075431_100018967 Ga0075431_1000189672 212
81 3300006852 Ga0075433_10066444 Ga0075433_100664442 212
82 3300006852 Ga0075433_10069124 Ga0075433_100691243 212
83 3300006871 Ga0075434_100019085 Ga0075434_1000190856 212
84 3300006871 Ga0075434_100025859 Ga0075434_1000258594 212
85 3300009147 Ga0114129_10103369 Ga0114129_101033692 212
86 3300009147 Ga0114129_10441014 Ga0114129_104410141 212
87 3300009148 Ga0105243_10111150 Ga0105243_101111502 212
88 3300009553 Ga0105249_10071453 Ga0105249_100714533 212
89 3300025961 Ga0207712_10093682 Ga0207712_100936822 212
90 3300037418 Ga0395900_0036847 Ga0395900_0036847_2536_3174 212
91 3300037418 Ga0395900_0197026 Ga0395900_0197026_570_1208 212
92 3300037466 Ga0395898_0008997 Ga0395898_0008997_8086_8724 212
93 3300037471 Ga0395905_0005751 Ga0395905_0005751_8203_8841 212
94 3300038443 Ga0395901_0010229 Ga0395901_0010229_8075_8713 212
95 3300038443 Ga0395901_0162142 Ga0395901_0162142_288_926 212
96 3300046537 Ga0495598_0039023 Ga0495598_0039023_41_679 212
97 3300048905 Ga0496102_0411541 Ga0496102_0411541_20_658 212
98 3300048906 Ga0496103_0136769 Ga0496103_0136769_542_1180 212
99 3300048909 Ga0496106_0101217 Ga0496106_0101217_1054_1692 212
100 3300048910 Ga0496107_0017511 Ga0496107_0017511_3692_4330 212
101 3300049568 Ga0501031_0254652 Ga0501031_0254652_333_971 212
102 3300049572 Ga0501036_0358701 Ga0501036_0358701_202_840 212
103 3300049580 Ga0501046_0518896 Ga0501046_0518896_175_813 212
104 3300049584 Ga0501068_0232225 Ga0501068_0232225_50_688 212
105 3300049588 Ga0501072_0096022 Ga0501072_0096022_1530_2168 212
106 3300049741 Ga0501079_0123620 Ga0501079_0123620_829_1467 212
107 3300049824 Ga0501045_0341804 Ga0501045_0341804_161_799 212
108 3300050491 nmdc:mga00v17_29986_c1 nmdc:mga00v17_29986_c1_56_694 212
109 3300050492 nmdc:mga0yw44_3344_c1 nmdc:mga0yw44_3344_c1_2348_2986 212
110 3300050492 nmdc:mga0yw44_8316_c1 nmdc:mga0yw44_8316_c1_2352_2990 212
111 3300050494 nmdc:mga06z11_357892_c1 nmdc:mga06z11_357892_c1_170_808 212
112 3300050494 nmdc:mga06z11_476681_c1 nmdc:mga06z11_476681_c1_49_687 212
113 3300050507 nmdc:mga05p37_170472_c1 nmdc:mga05p37_170472_c1_37_675 212
114 3300050507 nmdc:mga05p37_258552_c1 nmdc:mga05p37_258552_c1_794_1432 212
115 3300050507 nmdc:mga05p37_498488_c1 nmdc:mga05p37_498488_c1_708_1346 212
116 3300050510 nmdc:mga06r32_10710_c1 nmdc:mga06r32_10710_c1_3524_4162 212
117 3300050512 nmdc:mga0n895_85047_c1 nmdc:mga0n895_85047_c1_1774_2412 212
118 3300050512 nmdc:mga0n895_8684_c1 nmdc:mga0n895_8684_c1_3320_3958 212
119 3300050514 nmdc:mga08x19_286596_c1 nmdc:mga08x19_286596_c1_350_988 212
120 3300050515 nmdc:mga0a205_192171_c1 nmdc:mga0a205_192171_c1_1122_1760 212
121 3300050515 nmdc:mga0a205_298632_c1 nmdc:mga0a205_298632_c1_96_734 212
122 3300054114 Ga0501084_0366846 Ga0501084_0366846_15_653 212
123 3300060353 Ga0501082_0369081 Ga0501082_0369081_531_1169 212
124 3300005614 Ga0068856_100267945 Ga0068856_1002679452 213
125 3300037418 Ga0395900_0018848 Ga0395900_0018848_4397_5044 213
126 3300046536 Ga0495587_0002896 Ga0495587_0002896_3799_4440 213
127 3300005335 Ga0070666_10031716 Ga0070666_100317164 214
128 3300005548 Ga0070665_100003122 Ga0070665_1000031222 214
129 3300006028 Ga0070717_10079142 Ga0070717_100791422 214
130 3300006038 Ga0075365_10013106 Ga0075365_100131064 214
131 3300006038 Ga0075365_10131203 Ga0075365_101312032 214
132 3300006038 Ga0075365_10201667 Ga0075365_102016672 214
133 3300006051 Ga0075364_10083708 Ga0075364_100837082 214
134 3300006051 Ga0075364_10098472 Ga0075364_100984723 214
135 3300006051 Ga0075364_10153390 Ga0075364_101533902 214
136 3300006178 Ga0075367_10367166 Ga0075367_103671662 214
137 3300006353 Ga0075370_10099407 Ga0075370_100994073 214
138 3300006847 Ga0075431_100032119 Ga0075431_1000321196 214
139 3300009093 Ga0105240_10499158 Ga0105240_104991582 214
140 3300009098 Ga0105245_10484933 Ga0105245_104849333 214
141 3300021384 Ga0213876_10149753 Ga0213876_101497532 214
142 3300021388 Ga0213875_10047198 Ga0213875_100471983 214
143 3300025903 Ga0207680_10036278 Ga0207680_100362783 214
144 3300025928 Ga0207700_10000384 Ga0207700_100003842 214
145 3300025929 Ga0207664_10089430 Ga0207664_100894303 214
146 3300026023 Ga0207677_10000379 Ga0207677_100003793 214
147 3300028379 Ga0268266_10000376 Ga0268266_1000037648 214
148 3300031727 Ga0316576_10021613 Ga0316576_100216133 214
149 3300035398 Ga0316574_0032030 Ga0316574_0032030_2153_2800 214
150 3300036712 Ga0316584_0002367 Ga0316584_0002367_3634_4281 214
151 3300037466 Ga0395898_0002226 Ga0395898_0002226_19283_19972 214
152 3300037853 Ga0436364_1454144 Ga0436364_1454144_2079_2729 214
153 3300039437 Ga0436365_1718243 Ga0436365_1718243_1321_1971 214
154 3300044656 Ga0466969_0006715 Ga0466969_0006715_3994_4644 214
155 3300044684 Ga0466966_0131414 Ga0466966_0131414_45_695 214
156 3300045049 Ga0466959_0045537 Ga0466959_0045537_679_1329 214
157 3300045976 Ga0466967_0002279 Ga0466967_0002279_10995_11639 214
158 3300046459 Ga0495629_0000106 Ga0495629_0000106_2504_3148 214
159 3300046533 Ga0495640_0020566 Ga0495640_0020566_3019_3663 214
160 3300046543 Ga0495645_0001115 Ga0495645_0001115_16845_17489 214
161 3300046681 Ga0495647_0008965 Ga0495647_0008965_2054_2698 214
162 3300047319 Ga0495674_0000010 Ga0495674_0000010_63572_64216 214
163 3300047444 Ga0495675_0009985 Ga0495675_0009985_3631_4275 214
164 3300048911 Ga0496108_0246081 Ga0496108_0246081_806_1450 214
165 3300048912 Ga0496109_0000056 Ga0496109_0000056_95704_96348 214
166 3300049569 Ga0501032_0187825 Ga0501032_0187825_295_942 214
167 3300049570 Ga0501033_0207469 Ga0501033_0207469_198_845 214
168 3300049571 Ga0501034_0015320 Ga0501034_0015320_6562_7209 214
169 3300049571 Ga0501034_0038680 Ga0501034_0038680_2696_3343 214
170 3300049571 Ga0501034_0204846 Ga0501034_0204846_884_1531 214
171 3300049571 Ga0501034_0263962 Ga0501034_0263962_377_1024 214
172 3300049572 Ga0501036_0087108 Ga0501036_0087108_1291_1938 214
173 3300049575 Ga0501039_0050666 Ga0501039_0050666_1208_1852 214
174 3300049578 Ga0501042_0168441 Ga0501042_0168441_354_998 214
175 3300049588 Ga0501072_0031700 Ga0501072_0031700_2490_3134 214
176 3300049824 Ga0501045_0228128 Ga0501045_0228128_639_1283 214
177 3300050491 nmdc:mga00v17_19119_c1 nmdc:mga00v17_19119_c1_374_1021 214
178 3300050491 nmdc:mga00v17_285162_c1 nmdc:mga00v17_285162_c1_227_874 214
179 3300050492 nmdc:mga0yw44_156833_c1 nmdc:mga0yw44_156833_c1_190_837 214
180 3300050492 nmdc:mga0yw44_261114_c1 nmdc:mga0yw44_261114_c1_299_946 214
181 3300053078 Ga0495612_0030921 Ga0495612_0030921_995_1639 214
182 3300053083 Ga0495655_0030292 Ga0495655_0030292_52_696 214
183 3300053085 Ga0495619_0003472 Ga0495619_0003472_6791_7435 214
184 3300005985 Ga0081539_10068298 Ga0081539_100682982 215
185 3300045049 Ga0466959_0270936 Ga0466959_0270936_428_1081 215
186 3300061719 Ga0466962_0060274 Ga0466962_0060274_748_1401 215
187 3300003203 JGI25406J46586_10063855 JGI25406J46586_100638552 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

23

206

0.94

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

41

182

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9455 4 210
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.9401 4 210
7l0b-assembly1.cif.gz_A crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.9315 2 210
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9282 4 210
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.9271 4 210
ID Description Score Start End Superfamily
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9455 4 210 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9282 4 210 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9138 6 210 3.60.15.10
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8833 4 216 3.60.15.10
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8791 4 216 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2W6D3H2-F1-model_v4 MBL fold metallo-hydrolase 0.9831 6 144 GO:0016787
AF-A0A382YZU3-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9757 126 215 GO:0016787
AF-C8PNZ8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9747 129 206 GO:0016787
AF-A0A7D5NJ52-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9703 43 212 GO:0016787
AF-A0A2W6D3H2-F1-model_v4 MBL fold metallo-hydrolase 0.9693 6 144 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.09 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map