F287975

General Info

Members Datasets Scaffolds Average Seq Length
187 150 374 193

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0014177|Ga0373956_0014177_2478_3200
Length 224
Sequence MHINEYLMKAIQDDARRAGERDRLLLEARRRRTEMGKIVVSENVTLDGVIQDPAGDEGFRPGGWAGLIGNSPQLAKLALDEALAAGAFLLGRRSYEWLAARWPSRSGELADRLNSLPKYVVSATLANPAWNNSTVLKGDVLNEVSTLKQHIDGDIVIAGSFQLVRTLIEHDLVDELRLKIFPVALGAGERPFGETSDNKPMHLLDTQTLEGGIAYLTYQAVRDA

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
73 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
143 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
144 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
145 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
146 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
147 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
148 2808606394 Promicromonospora sp. C35 Isolate Unclassified
149 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
150 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 0
Isolates 4.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.53
Rhizoplane 4.28
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0014177 3300035119 Bacteria 3325
2 JGI25407J50210_10001123 3300003373 Bacteria 5898
3 JGI25407J50210_10016667 3300003373 Bacteria 1904
4 Ga0070683_100267176 3300005329 Bacteria 1627
5 Ga0070682_100002689 3300005337 Bacteria 9833
6 Ga0070671_100064857 3300005355 Bacteria 3042
7 Ga0070703_10163963 3300005406 Bacteria 845
8 Ga0070709_10000805 3300005434 Bacteria 17483
9 Ga0070714_100015771 3300005435 Bacteria 6087
10 Ga0070713_100011989 3300005436 Bacteria 6342
11 Ga0070710_10007079 3300005437 Bacteria 5415
12 Ga0070711_100007843 3300005439 Bacteria 6507
13 Ga0070708_100042247 3300005445 Bacteria 4001
14 Ga0070708_100277345 3300005445 Bacteria 1577
15 Ga0070662_101054545 3300005457 Bacteria 697
16 Ga0070706_100007510 3300005467 Bacteria 10218
17 Ga0070706_100282949 3300005467 Bacteria 1548
18 Ga0070706_100510288 3300005467 Bacteria 1118
19 Ga0070706_100636217 3300005467 Bacteria 990
20 Ga0070707_100003220 3300005468 Bacteria 15447
21 Ga0070707_100018983 3300005468 Bacteria 6476
22 Ga0070698_100006391 3300005471 Bacteria 12795
23 Ga0070698_100020361 3300005471 Bacteria 6952
24 Ga0070698_100179989 3300005471 Bacteria 2053
25 Ga0070699_100003149 3300005518 Bacteria 14600
26 Ga0070699_100259632 3300005518 Bacteria 1554
27 Ga0070699_100512317 3300005518 Bacteria 1090
28 Ga0070679_100418679 3300005530 Bacteria 1285
29 Ga0070697_100104373 3300005536 Bacteria 2357
30 Ga0070697_100713538 3300005536 Bacteria 885
31 Ga0070672_101152529 3300005543 Bacteria 690
32 Ga0068857_100009337 3300005577 Bacteria 8514
33 Ga0068856_101239764 3300005614 Bacteria 762
34 Ga0081538_10000225 3300005981 Bacteria 63512
35 Ga0081538_10000819 3300005981 Bacteria 33745
36 Ga0081538_10025637 3300005981 Bacteria 4149
37 Ga0081540_1002203 3300005983 Bacteria 16098
38 Ga0070717_10005219 3300006028 Bacteria 9464
39 Ga0070717_10198145 3300006028 Bacteria 1758
40 Ga0075365_10072288 3300006038 Bacteria 2323
41 Ga0075368_10328523 3300006042 Unclassified 663
42 Ga0075432_10052266 3300006058 Bacteria 1443
43 Ga0070716_100001059 3300006173 Bacteria 12048
44 Ga0070716_100059080 3300006173 Bacteria 2209
45 Ga0070712_100006641 3300006175 Bacteria 7192
46 Ga0075428_100013247 3300006844 Bacteria 9175
47 Ga0075430_100096380 3300006846 Bacteria 2472
48 Ga0075431_100030855 3300006847 Bacteria 5521
49 Ga0075434_100266156 3300006871 Bacteria 1733
50 Ga0075429_100011695 3300006880 Bacteria 7611
51 Ga0075435_100307427 3300007076 Bacteria 1356
52 Ga0105240_10703892 3300009093 Bacteria 1102
53 Ga0111539_10004143 3300009094 Bacteria 19017
54 Ga0111539_10193676 3300009094 Bacteria 2371
55 Ga0105245_10093235 3300009098 Bacteria 2774
56 Ga0114129_10035341 3300009147 Bacteria 7059
57 Ga0114129_10317242 3300009147 Bacteria 2073
58 Ga0105243_10347570 3300009148 Bacteria 1361
59 Ga0105241_10270547 3300009174 Bacteria 1447
60 Ga0105242_10835962 3300009176 Bacteria 915
61 Ga0105246_10587678 3300011119 Bacteria 960
62 Ga0157374_10336217 3300013296 Bacteria 1498
63 Ga0163162_11058834 3300013306 Bacteria 918
64 Ga0163162_11560901 3300013306 Bacteria 753
65 Ga0157372_10198313 3300013307 Bacteria 2325
66 Ga0157379_10801299 3300014968 Bacteria 889
67 Ga0207692_10011467 3300025898 Bacteria 3774
68 Ga0207692_10063992 3300025898 Bacteria 1913
69 Ga0207685_10017142 3300025905 Bacteria 2334
70 Ga0207684_10017985 3300025910 Bacteria 6057
71 Ga0207684_10795481 3300025910 Bacteria 800
72 Ga0207693_10001952 3300025915 Bacteria 18069
73 Ga0207663_10341481 3300025916 Bacteria 1131
74 Ga0207657_10152556 3300025919 Bacteria 1881
75 Ga0207646_10001398 3300025922 Bacteria 29943
76 Ga0207646_10052899 3300025922 Bacteria 3633
77 Ga0207664_10002176 3300025929 Bacteria 12894
78 Ga0207664_10012554 3300025929 Bacteria 6061
79 Ga0207709_10224563 3300025935 Bacteria 1357
80 Ga0207669_10496565 3300025937 Bacteria 976
81 Ga0207661_10008172 3300025944 Bacteria 7470
82 Ga0207679_10039720 3300025945 Unclassified 3363
83 Ga0207703_10612645 3300026035 Bacteria 1030
84 Ga0207674_10007403 3300026116 Bacteria 12789
85 Ga0207428_10005770 3300027907 Bacteria 11493
86 Ga0268265_10538343 3300028380 Bacteria 1107
87 Ga0316176_1052730 3300030732 Bacteria 1482
88 Ga0316181_1000229 3300030744 Bacteria 1278
89 Ga0316181_1110150 3300030744 Bacteria 961
90 Ga0265313_10170442 3300031595 Bacteria 920
91 Ga0307406_10078275 3300031901 Bacteria 2190
92 Ga0307406_10577940 3300031901 Bacteria 923
93 Ga0307409_101306630 3300031995 Bacteria 750
94 Ga0307416_100726550 3300032002 Bacteria 1084
95 Ga0307415_100283434 3300032126 Bacteria 1364
96 Ga0307415_100580070 3300032126 Bacteria 994
97 Ga0373929_0047725 3300035085 Bacteria 971
98 Ga0373952_0029605 3300035092 Bacteria 1208
99 Ga0373936_0152461 3300035113 Bacteria 1002
100 Ga0373939_0127204 3300035114 Bacteria 905
101 Ga0373945_0129059 3300035116 Bacteria 1011
102 Ga0373943_0235841 3300035170 Bacteria 1023
103 Ga0373935_0616176 3300035692 Bacteria 794
104 Ga0373933_0065464 3300035724 Bacteria 2200
105 Ga0373925_0206477 3300037068 Bacteria 1564
106 Ga0395900_0435208 3300037418 Bacteria 1270
107 Ga0395898_0732632 3300037466 Bacteria 930
108 Ga0395905_0101009 3300037471 Bacteria 2708
109 Ga0395901_0068642 3300038443 Bacteria 3693
110 Ga0395901_0077502 3300038443 Bacteria 3469
111 Ga0395901_0136731 3300038443 Bacteria 2575
112 Ga0395901_0167593 3300038443 Bacteria 2306
113 Ga0436361_0001964 3300039447 Bacteria 1636
114 Ga0451837_1486117 3300041494 Bacteria 784
115 Ga0466963_0720877 3300044694 Bacteria 704
116 Ga0466968_0017678 3300044735 Bacteria 2854
117 Ga0466960_0341773 3300044901 Bacteria 852
118 Ga0495592_0048190 3300046454 Bacteria 3170
119 Ga0495592_0570437 3300046454 Bacteria 693
120 Ga0495629_0482173 3300046459 Bacteria 837
121 Ga0495641_0143840 3300046461 Bacteria 1065
122 Ga0495651_0157378 3300046462 Bacteria 1631
123 Ga0495651_0466466 3300046462 Bacteria 813
124 Ga0495653_0040505 3300046463 Bacteria 3640
125 Ga0495653_0299476 3300046463 Unclassified 1049
126 Ga0495639_0227361 3300046475 Bacteria 918
127 Ga0495664_0060055 3300046477 Bacteria 2263
128 Ga0495664_0185959 3300046477 Bacteria 1259
129 Ga0495608_0097695 3300046511 Bacteria 1895
130 Ga0495618_0005197 3300046514 Bacteria 7953
131 Ga0495630_0505142 3300046517 Bacteria 927
132 Ga0495652_0303736 3300046529 Unclassified 1159
133 Ga0495665_0338827 3300046531 Bacteria 766
134 Ga0495640_0062991 3300046533 Bacteria 2513
135 Ga0495586_0163427 3300046535 Unclassified 1256
136 Ga0495645_0049015 3300046543 Bacteria 3076
137 Ga0495622_0167615 3300046557 Bacteria 989
138 Ga0495634_0025559 3300046642 Bacteria 4129
139 Ga0495625_0170364 3300046660 Bacteria 1454
140 Ga0495635_0020081 3300046663 Bacteria 4656
141 Ga0495635_0164311 3300046663 Bacteria 1510
142 Ga0495588_0088791 3300046674 Bacteria 1618
143 Ga0495657_0018721 3300046675 Bacteria 5003
144 Ga0495623_0157273 3300046679 Bacteria 1338
145 Ga0495646_0052828 3300046680 Bacteria 2452
146 Ga0495613_0014141 3300046689 Bacteria 5921
147 Ga0495624_0276770 3300046690 Bacteria 1013
148 Ga0495589_0022004 3300046794 Bacteria 3257
149 Ga0495600_0011007 3300046809 Bacteria 5628
150 Ga0495604_0056425 3300047317 Bacteria 3023
151 Ga0495636_0020560 3300047318 Bacteria 2660
152 Ga0495636_0278874 3300047318 Bacteria 778
153 Ga0495674_0011996 3300047319 Bacteria 8171
154 Ga0495674_0094145 3300047319 Bacteria 2555
155 Ga0495676_0245595 3300047321 Unclassified 1224
156 Ga0495680_0016890 3300047322 Bacteria 6250
157 Ga0495680_0172481 3300047322 Bacteria 1565
158 Ga0495685_001677 3300047447 Bacteria 6830
159 Ga0495684_0007711 3300047471 Bacteria 8331
160 Ga0495602_0573239 3300048088 Bacteria 779
161 Ga0496100_0262028 3300048903 Bacteria 1282
162 Ga0496102_0684578 3300048905 Bacteria 948
163 Ga0496103_0060881 3300048906 Bacteria 2347
164 Ga0496105_0011234 3300048908 Bacteria 7065
165 Ga0496112_1004156 3300048915 Bacteria 754
166 Ga0496113_0104952 3300048916 Bacteria 2193
167 Ga0496114_0077468 3300048917 Bacteria 2803
168 Ga0496115_0001090 3300048918 Bacteria 19632
169 Ga0501068_0185200 3300049584 Bacteria 1317
170 nmdc:mga00v17_52051_c1 3300050491 Bacteria 2491
171 nmdc:mga0yw44_288893_c1 3300050492 Bacteria 1097
172 nmdc:mga05p37_6142_c1 3300050507 Bacteria 14134
173 nmdc:mga05p37_975779_c1 3300050507 Bacteria 903
174 nmdc:mga09592_56042_c1 3300050508 Bacteria 3331
175 nmdc:mga0qj67_414375_c1 3300050509 Bacteria 1087
176 nmdc:mga08y16_6932_c1 3300050511 Bacteria 11877
177 Ga0495601_0107426 3300053077 Bacteria 1805
178 Ga0590075_044589 3300059424 Bacteria 1135
179 2689993433 2687453743 Bacteria 8361025
180 2738698075 2738541272 Bacteria 6848551
181 2739328478 2738543027 Bacteria 6409078
182 2739604557 2739367654 Bacteria 6049412
183 2760308432 2758568522 Bacteria 5953541
184 2760622908 2758568621 Bacteria 5967089
185 2809027728 2808606394 Bacteria 6248540
186 2895888744 2895880812 Bacteria 11255272
187 8056581667 8056579771 Bacteria 5840325
188 Ga0373956_0014177
189 JGI25407J50210_10001123
190 JGI25407J50210_10016667
191 Ga0070683_100267176
192 Ga0070682_100002689
193 Ga0070671_100064857
194 Ga0070703_10163963
195 Ga0070709_10000805
196 Ga0070714_100015771
197 Ga0070713_100011989
198 Ga0070710_10007079
199 Ga0070711_100007843
200 Ga0070708_100042247
201 Ga0070708_100277345
202 Ga0070662_101054545
203 Ga0070706_100007510
204 Ga0070706_100282949
205 Ga0070706_100510288
206 Ga0070706_100636217
207 Ga0070707_100003220
208 Ga0070707_100018983
209 Ga0070698_100006391
210 Ga0070698_100020361
211 Ga0070698_100179989
212 Ga0070699_100003149
213 Ga0070699_100259632
214 Ga0070699_100512317
215 Ga0070679_100418679
216 Ga0070697_100104373
217 Ga0070697_100713538
218 Ga0070672_101152529
219 Ga0068857_100009337
220 Ga0068856_101239764
221 Ga0081538_10000225
222 Ga0081538_10000819
223 Ga0081538_10025637
224 Ga0081540_1002203
225 Ga0070717_10005219
226 Ga0070717_10198145
227 Ga0075365_10072288
228 Ga0075368_10328523
229 Ga0075432_10052266
230 Ga0070716_100001059
231 Ga0070716_100059080
232 Ga0070712_100006641
233 Ga0075428_100013247
234 Ga0075430_100096380
235 Ga0075431_100030855
236 Ga0075434_100266156
237 Ga0075429_100011695
238 Ga0075435_100307427
239 Ga0105240_10703892
240 Ga0111539_10004143
241 Ga0111539_10193676
242 Ga0105245_10093235
243 Ga0114129_10035341
244 Ga0114129_10317242
245 Ga0105243_10347570
246 Ga0105241_10270547
247 Ga0105242_10835962
248 Ga0105246_10587678
249 Ga0157374_10336217
250 Ga0163162_11058834
251 Ga0163162_11560901
252 Ga0157372_10198313
253 Ga0157379_10801299
254 Ga0207692_10011467
255 Ga0207692_10063992
256 Ga0207685_10017142
257 Ga0207684_10017985
258 Ga0207684_10795481
259 Ga0207693_10001952
260 Ga0207663_10341481
261 Ga0207657_10152556
262 Ga0207646_10001398
263 Ga0207646_10052899
264 Ga0207664_10002176
265 Ga0207664_10012554
266 Ga0207709_10224563
267 Ga0207669_10496565
268 Ga0207661_10008172
269 Ga0207679_10039720
270 Ga0207703_10612645
271 Ga0207674_10007403
272 Ga0207428_10005770
273 Ga0268265_10538343
274 Ga0316176_1052730
275 Ga0316181_1000229
276 Ga0316181_1110150
277 Ga0265313_10170442
278 Ga0307406_10078275
279 Ga0307406_10577940
280 Ga0307409_101306630
281 Ga0307416_100726550
282 Ga0307415_100283434
283 Ga0307415_100580070
284 Ga0373929_0047725
285 Ga0373952_0029605
286 Ga0373936_0152461
287 Ga0373939_0127204
288 Ga0373945_0129059
289 Ga0373943_0235841
290 Ga0373935_0616176
291 Ga0373933_0065464
292 Ga0373925_0206477
293 Ga0395900_0435208
294 Ga0395898_0732632
295 Ga0395905_0101009
296 Ga0395901_0068642
297 Ga0395901_0077502
298 Ga0395901_0136731
299 Ga0395901_0167593
300 Ga0436361_0001964
301 Ga0451837_1486117
302 Ga0466963_0720877
303 Ga0466968_0017678
304 Ga0466960_0341773
305 Ga0495592_0048190
306 Ga0495592_0570437
307 Ga0495629_0482173
308 Ga0495641_0143840
309 Ga0495651_0157378
310 Ga0495651_0466466
311 Ga0495653_0040505
312 Ga0495653_0299476
313 Ga0495639_0227361
314 Ga0495664_0060055
315 Ga0495664_0185959
316 Ga0495608_0097695
317 Ga0495618_0005197
318 Ga0495630_0505142
319 Ga0495652_0303736
320 Ga0495665_0338827
321 Ga0495640_0062991
322 Ga0495586_0163427
323 Ga0495645_0049015
324 Ga0495622_0167615
325 Ga0495634_0025559
326 Ga0495625_0170364
327 Ga0495635_0020081
328 Ga0495635_0164311
329 Ga0495588_0088791
330 Ga0495657_0018721
331 Ga0495623_0157273
332 Ga0495646_0052828
333 Ga0495613_0014141
334 Ga0495624_0276770
335 Ga0495589_0022004
336 Ga0495600_0011007
337 Ga0495604_0056425
338 Ga0495636_0020560
339 Ga0495636_0278874
340 Ga0495674_0011996
341 Ga0495674_0094145
342 Ga0495676_0245595
343 Ga0495680_0016890
344 Ga0495680_0172481
345 Ga0495685_001677
346 Ga0495684_0007711
347 Ga0495602_0573239
348 Ga0496100_0262028
349 Ga0496102_0684578
350 Ga0496103_0060881
351 Ga0496105_0011234
352 Ga0496112_1004156
353 Ga0496113_0104952
354 Ga0496114_0077468
355 Ga0496115_0001090
356 Ga0501068_0185200
357 nmdc:mga00v17_52051_c1
358 nmdc:mga0yw44_288893_c1
359 nmdc:mga05p37_6142_c1
360 nmdc:mga05p37_975779_c1
361 nmdc:mga09592_56042_c1
362 nmdc:mga0qj67_414375_c1
363 nmdc:mga08y16_6932_c1
364 Ga0495601_0107426
365 Ga0590075_044589
366 2689993433
367 2738698075
368 2739328478
369 2739604557
370 2760308432
371 2760622908
372 2809027728
373 2895888744
374 8056581667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

36

215

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8029 2 183
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7969 1 183
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7967 1 184
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7928 1 183
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7884 1 184
ID Description Score Start End Superfamily
af_B0G189_453_564_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8001 163 182 3.30.70.240
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7967 1 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7945 2 180 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7899 2 180 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7884 1 184 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7W0GG77-F1-model_v4 Dihydrofolate reductase family protein 0.9539 29 184 GO:0008703
GO:0009231
AF-A0A8A5UII7-F1-model_v4 deleted 0.9476 2 184
AF-A0A2K9EQW4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9468 1 184 GO:0008703
GO:0009231
AF-A0A7W7Q985-F1-model_v4 Dihydrofolate reductase 0.9441 1 183 GO:0008703
GO:0009231
AF-C7QKD6-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9408 1 183 GO:0008703
GO:0009231

Map