F287909

General Info

Members Datasets Scaffolds Average Seq Length
187 171 374 257

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10003682|Ga0307516_1000368218
Length 300
Sequence MRSIPGIDPLRPDAAGSYQAGQLHCRGRQLTSSVPPTGRRVDTHRSEPLVSMPDFYDDLAPLYHLIHQDWDASIRRQGEQLTALIKTEWPKSKRVLDVSCGIGTQAIGLAQHSYSVVGSDISANAVGRAEQEARVRGTKVLFAVCDMRQAHXXXGSGFDVVISCDNSLPHLLTDDDLLLALKEMLACLSAGGGCVISVRDYETEERGTNIVKSYGVRTERGKRYLIFQVWDFDGEQYDLAFFFVEEDLSSSKVKTHVMRSRYYAISITCLLELMRQAGFKNVRRLDHTFYQPVLVGTRTE

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
142 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
143 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
144 2643221683 Variovorax sp. Root473 Isolate Unclassified
145 2738541277 Variovorax sp. GV051 Isolate Unclassified
146 2738543019 Variovorax sp. GV040 Isolate Unclassified
147 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
148 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
149 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
150 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
151 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
152 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
153 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
154 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
155 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
156 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
157 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
158 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
159 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
160 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
161 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
162 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
163 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
164 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
165 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
166 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
167 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
168 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
169 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
170 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
171 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.96
Metatranscriptomes 0
Isolates 16.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 1.07
Rhizoplane 2.14
Rhizosphere 82.89
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10003682 3300031730 Bacteria 19481
2 rootH1_10134097 3300003316 Bacteria 1287
3 rootL2_10362220 3300003322 Bacteria 1123
4 rootH1_10050611 3300003323 Bacteria 2254
5 Ga0055540_1000373 3300003792 Bacteria 37469
6 Ga0065707_10122289 3300005295 Bacteria 2086
7 Ga0070683_100403077 3300005329 Bacteria 1304
8 Ga0070682_100071211 3300005337 Bacteria 2224
9 Ga0070668_100294171 3300005347 Bacteria 1360
10 Ga0070674_100366814 3300005356 Bacteria 1167
11 Ga0070700_100417370 3300005441 Unclassified 1013
12 Ga0070663_100161294 3300005455 Bacteria 1726
13 Ga0070678_100244079 3300005456 Bacteria 1503
14 Ga0070662_100100765 3300005457 Bacteria 2185
15 Ga0070699_100714736 3300005518 Unclassified 916
16 Ga0070684_100175695 3300005535 Bacteria 1946
17 Ga0068853_100069235 3300005539 Unclassified 3069
18 Ga0068857_100187072 3300005577 Bacteria 1885
19 Ga0068856_100112347 3300005614 Bacteria 2722
20 Ga0068852_100799029 3300005616 Unclassified 957
21 Ga0068864_100099396 3300005618 Bacteria 2577
22 Ga0068863_100052751 3300005841 Bacteria 3853
23 Ga0068863_100081032 3300005841 Bacteria 3075
24 Ga0081455_10080188 3300005937 Bacteria 2677
25 Ga0081539_10026793 3300005985 Bacteria 3665
26 Ga0075365_10017585 3300006038 Bacteria 4378
27 Ga0075363_100176853 3300006048 Bacteria 1213
28 Ga0097621_100039049 3300006237 Bacteria 3811
29 Ga0068871_100004262 3300006358 Bacteria 9920
30 Ga0075434_100005142 3300006871 Bacteria 11879
31 Ga0075429_100093994 3300006880 Bacteria 2615
32 Ga0075435_100093538 3300007076 Bacteria 2484
33 Ga0105240_10015823 3300009093 Bacteria 10234
34 Ga0105245_10386176 3300009098 Bacteria 1395
35 Ga0114129_10105841 3300009147 Bacteria 3887
36 Ga0114129_11264771 3300009147 Bacteria 916
37 Ga0105243_10529220 3300009148 Bacteria 1122
38 Ga0105241_10308279 3300009174 Bacteria 1361
39 Ga0105242_10346221 3300009176 Bacteria 1371
40 Ga0105237_10010778 3300009545 Bacteria 9702
41 Ga0105238_10327279 3300009551 Bacteria 1519
42 Ga0105249_10212524 3300009553 Bacteria 1899
43 Ga0105249_10663720 3300009553 Bacteria 1101
44 Ga0105239_10386057 3300010375 Bacteria 1584
45 Ga0105239_10500829 3300010375 Bacteria 1381
46 Ga0157369_10176822 3300013105 Bacteria 2247
47 Ga0157378_10197266 3300013297 Bacteria 1902
48 Ga0157372_10160302 3300013307 Bacteria 2600
49 Ga0157375_10163750 3300013308 Bacteria 2368
50 Ga0157380_10352614 3300014326 Bacteria 1377
51 Ga0157380_10467270 3300014326 Bacteria 1216
52 Ga0157379_10356561 3300014968 Bacteria 1340
53 Ga0157376_10040742 3300014969 Bacteria 3798
54 Ga0157376_10089879 3300014969 Bacteria 2656
55 Ga0183367_1012 3300015688 Bacteria 347438
56 Ga0163161_10455033 3300017792 Bacteria 1035
57 Ga0209676_1000071 3300025292 Bacteria 309464
58 Ga0207426_1014997 3300025302 Bacteria 2827
59 Ga0209051_1000511 3300025303 Bacteria 49102
60 Ga0209257_1002310 3300025304 Bacteria 19281
61 Ga0207680_10467065 3300025903 Bacteria 897
62 Ga0207695_10100286 3300025913 Bacteria 2892
63 Ga0207690_10044028 3300025932 Bacteria 2940
64 Ga0207706_10188595 3300025933 Bacteria 1810
65 Ga0207689_10143831 3300025942 Bacteria 1965
66 Ga0207679_10086759 3300025945 Bacteria 2408
67 Ga0207712_10059065 3300025961 Bacteria 2713
68 Ga0207668_10309046 3300025972 Bacteria 1308
69 Ga0207708_10006803 3300026075 Bacteria 8457
70 Ga0207702_10264875 3300026078 Bacteria 1619
71 Ga0207641_10009108 3300026088 Bacteria 8200
72 Ga0207641_10026468 3300026088 Bacteria 4787
73 Ga0207676_10069069 3300026095 Bacteria 2828
74 Ga0209982_1026212 3300027552 Unclassified 908
75 Ga0307508_10022981 3300031616 Bacteria 5666
76 Ga0316576_10315487 3300031727 Unclassified 1167
77 Ga0307415_100331657 3300032126 Bacteria 1273
78 Ga0373932_0066595 3300035112 Unclassified 1107
79 Ga0373941_0010902 3300035115 Bacteria 2337
80 Ga0373931_0029370 3300035691 Bacteria 2822
81 Ga0395900_0000491 3300037418 Bacteria 55920
82 Ga0395898_0004332 3300037466 Bacteria 15539
83 Ga0395898_0029551 3300037466 Bacteria 5489
84 Ga0395905_0000979 3300037471 Bacteria 36648
85 Ga0436364_1237174 3300037853 Bacteria 1868
86 Ga0436365_1225338 3300039437 Bacteria 13485
87 Ga0436360_0949905 3300039438 Bacteria 4185
88 Ga0439455_0002109 3300042012 Bacteria 3547
89 Ga0450903_000054 3300042138 Bacteria 23481
90 Ga0439458_0000021 3300042157 Bacteria 24267
91 Ga0439458_0003807 3300042157 Bacteria 3490
92 Ga0466972_0001188 3300044658 Bacteria 12511
93 Ga0466965_0000125 3300044683 Bacteria 21878
94 Ga0466968_0001769 3300044735 Bacteria 7787
95 Ga0466967_0022577 3300045976 Bacteria 5138
96 Ga0495627_073674 3300046453 Bacteria 995
97 Ga0495592_0058732 3300046454 Bacteria 2836
98 Ga0495603_0140496 3300046455 Bacteria 1405
99 Ga0495662_0000182 3300046476 Bacteria 25321
100 Ga0495608_0051190 3300046511 Bacteria 2738
101 Ga0495628_0269951 3300046516 Bacteria 1266
102 Ga0495630_0142663 3300046517 Bacteria 1821
103 Ga0495666_0006854 3300046526 Bacteria 5720
104 Ga0495640_0013937 3300046533 Bacteria 6100
105 Ga0495586_0040698 3300046535 Bacteria 2501
106 Ga0495587_0012955 3300046536 Bacteria 5242
107 Ga0495634_0095938 3300046642 Bacteria 1920
108 Ga0495611_0013837 3300046648 Bacteria 3440
109 Ga0495599_0028147 3300046678 Bacteria 3521
110 Ga0495646_0200609 3300046680 Bacteria 1086
111 Ga0495669_0138981 3300046684 Unclassified 1146
112 Ga0495613_0001201 3300046689 Bacteria 19778
113 Ga0495613_0046395 3300046689 Bacteria 3213
114 Ga0495600_0002754 3300046809 Bacteria 10186
115 Ga0495600_0018747 3300046809 Bacteria 4413
116 Ga0495604_0006488 3300047317 Bacteria 9271
117 Ga0495604_0286994 3300047317 Bacteria 1110
118 Ga0495676_0013938 3300047321 Bacteria 7205
119 Ga0495676_0134594 3300047321 Bacteria 1779
120 Ga0495676_0179668 3300047321 Bacteria 1484
121 Ga0495683_0104825 3300047323 Bacteria 1356
122 Ga0495687_055122 3300047443 Bacteria 1664
123 Ga0495675_0075617 3300047444 Bacteria 2122
124 Ga0495685_058920 3300047447 Bacteria 1296
125 Ga0495593_0152567 3300047673 Bacteria 1168
126 Ga0496104_0444475 3300048907 Bacteria 1208
127 Ga0496107_0054663 3300048910 Bacteria 2882
128 Ga0496108_0016118 3300048911 Bacteria 6092
129 Ga0496110_0250747 3300048913 Bacteria 1611
130 Ga0496123_0024596 3300048926 Bacteria 4573
131 Ga0501033_0020913 3300049570 Bacteria 4939
132 Ga0501034_0450787 3300049571 Bacteria 1204
133 Ga0501036_0013005 3300049572 Bacteria 6910
134 Ga0501036_0017403 3300049572 Bacteria 6008
135 Ga0501038_0031051 3300049574 Bacteria 4723
136 Ga0501039_0019117 3300049575 Bacteria 5256
137 Ga0501043_0031130 3300049579 Bacteria 4195
138 Ga0501068_0037070 3300049584 Bacteria 2919
139 Ga0501069_0106495 3300049585 Bacteria 1594
140 Ga0501070_0083000 3300049586 Bacteria 2652
141 Ga0501073_0150826 3300049589 Unclassified 1611
142 Ga0501074_0014962 3300049590 Bacteria 5645
143 Ga0501076_0199115 3300049592 Bacteria 1635
144 Ga0501077_0050153 3300049593 Plasmid 2653
145 Ga0501079_0352567 3300049741 Bacteria 1153
146 Ga0501035_0002069 3300049822 Bacteria 19967
147 Ga0501035_0008510 3300049822 Bacteria 9554
148 nmdc:mga03n38_288953_c1 3300050490 Bacteria 877
149 nmdc:mga0yw44_463671_c1 3300050492 Unclassified 859
150 nmdc:mga09592_88810_c1 3300050508 Bacteria 2640
151 nmdc:mga0qj67_284213_c1 3300050509 Bacteria 1341
152 nmdc:mga0n895_14648_c1 3300050512 Bacteria 7131
153 nmdc:mga0rr50_30116_c1 3300050513 Bacteria 3838
154 nmdc:mga0a205_69450_c1 3300050515 Bacteria 3401
155 Ga0495601_0317261 3300053077 Bacteria 1015
156 Ga0500644_0004068 3300053088 Bacteria 3638
157 Ga0500573_0077554 3300053140 Bacteria 1891
158 2585305779 2582581313 Bacteria 10042643
159 2616701970 2616644814 Bacteria 11555299
160 2644466720 2643221683 Bacteria 5749203
161 2738722370 2738541277 Bacteria 7458140
162 2739282734 2738543019 Bacteria 7459457
163 2785366480 2784746768 Bacteria 10036182
164 2786667536 2786546132 Bacteria 10419719
165 2857538273 2857537821 Bacteria 5248181
166 2862282227 2862281513 Bacteria 9621493
167 2862390828 2862382967 Bacteria 10317375
168 2877684051 2877676314 Bacteria 9512378
169 2888583856 2888578766 Bacteria 6743310
170 2889054453 2889049205 Bacteria 7524325
171 2904758563 2904755435 Bacteria 7986759
172 2918508412 2918501144 Bacteria 8668083
173 2954673675 2954673503 Bacteria 9685905
174 2954690314 2954682443 Bacteria 9862841
175 2954700152 2954691527 Bacteria 10720516
176 2954702076 2954701450 Bacteria 10834262
177 2954718941 2954711539 Bacteria 10867210
178 2954728911 2954721474 Bacteria 10456478
179 2954732900 2954731030 Bacteria 10243860
180 2954747810 2954740390 Bacteria 10229294
181 2954751778 2954749733 Bacteria 10366972
182 2954766935 2954759201 Bacteria 9358192
183 3001268926 3001267043 Bacteria 4823521
184 3001272212 3001272096 Bacteria 4729684
185 3006991028 3006988479 Bacteria 4767936
186 8008565019 8008558824 Bacteria 10610750
187 8008581799 8008574985 Bacteria 7815457
188 Ga0307516_10003682
189 rootH1_10134097
190 rootL2_10362220
191 rootH1_10050611
192 Ga0055540_1000373
193 Ga0065707_10122289
194 Ga0070683_100403077
195 Ga0070682_100071211
196 Ga0070668_100294171
197 Ga0070674_100366814
198 Ga0070700_100417370
199 Ga0070663_100161294
200 Ga0070678_100244079
201 Ga0070662_100100765
202 Ga0070699_100714736
203 Ga0070684_100175695
204 Ga0068853_100069235
205 Ga0068857_100187072
206 Ga0068856_100112347
207 Ga0068852_100799029
208 Ga0068864_100099396
209 Ga0068863_100052751
210 Ga0068863_100081032
211 Ga0081455_10080188
212 Ga0081539_10026793
213 Ga0075365_10017585
214 Ga0075363_100176853
215 Ga0097621_100039049
216 Ga0068871_100004262
217 Ga0075434_100005142
218 Ga0075429_100093994
219 Ga0075435_100093538
220 Ga0105240_10015823
221 Ga0105245_10386176
222 Ga0114129_10105841
223 Ga0114129_11264771
224 Ga0105243_10529220
225 Ga0105241_10308279
226 Ga0105242_10346221
227 Ga0105237_10010778
228 Ga0105238_10327279
229 Ga0105249_10212524
230 Ga0105249_10663720
231 Ga0105239_10386057
232 Ga0105239_10500829
233 Ga0157369_10176822
234 Ga0157378_10197266
235 Ga0157372_10160302
236 Ga0157375_10163750
237 Ga0157380_10352614
238 Ga0157380_10467270
239 Ga0157379_10356561
240 Ga0157376_10040742
241 Ga0157376_10089879
242 Ga0183367_1012
243 Ga0163161_10455033
244 Ga0209676_1000071
245 Ga0207426_1014997
246 Ga0209051_1000511
247 Ga0209257_1002310
248 Ga0207680_10467065
249 Ga0207695_10100286
250 Ga0207690_10044028
251 Ga0207706_10188595
252 Ga0207689_10143831
253 Ga0207679_10086759
254 Ga0207712_10059065
255 Ga0207668_10309046
256 Ga0207708_10006803
257 Ga0207702_10264875
258 Ga0207641_10009108
259 Ga0207641_10026468
260 Ga0207676_10069069
261 Ga0209982_1026212
262 Ga0307508_10022981
263 Ga0316576_10315487
264 Ga0307415_100331657
265 Ga0373932_0066595
266 Ga0373941_0010902
267 Ga0373931_0029370
268 Ga0395900_0000491
269 Ga0395898_0004332
270 Ga0395898_0029551
271 Ga0395905_0000979
272 Ga0436364_1237174
273 Ga0436365_1225338
274 Ga0436360_0949905
275 Ga0439455_0002109
276 Ga0450903_000054
277 Ga0439458_0000021
278 Ga0439458_0003807
279 Ga0466972_0001188
280 Ga0466965_0000125
281 Ga0466968_0001769
282 Ga0466967_0022577
283 Ga0495627_073674
284 Ga0495592_0058732
285 Ga0495603_0140496
286 Ga0495662_0000182
287 Ga0495608_0051190
288 Ga0495628_0269951
289 Ga0495630_0142663
290 Ga0495666_0006854
291 Ga0495640_0013937
292 Ga0495586_0040698
293 Ga0495587_0012955
294 Ga0495634_0095938
295 Ga0495611_0013837
296 Ga0495599_0028147
297 Ga0495646_0200609
298 Ga0495669_0138981
299 Ga0495613_0001201
300 Ga0495613_0046395
301 Ga0495600_0002754
302 Ga0495600_0018747
303 Ga0495604_0006488
304 Ga0495604_0286994
305 Ga0495676_0013938
306 Ga0495676_0134594
307 Ga0495676_0179668
308 Ga0495683_0104825
309 Ga0495687_055122
310 Ga0495675_0075617
311 Ga0495685_058920
312 Ga0495593_0152567
313 Ga0496104_0444475
314 Ga0496107_0054663
315 Ga0496108_0016118
316 Ga0496110_0250747
317 Ga0496123_0024596
318 Ga0501033_0020913
319 Ga0501034_0450787
320 Ga0501036_0013005
321 Ga0501036_0017403
322 Ga0501038_0031051
323 Ga0501039_0019117
324 Ga0501043_0031130
325 Ga0501068_0037070
326 Ga0501069_0106495
327 Ga0501070_0083000
328 Ga0501073_0150826
329 Ga0501074_0014962
330 Ga0501076_0199115
331 Ga0501077_0050153
332 Ga0501079_0352567
333 Ga0501035_0002069
334 Ga0501035_0008510
335 nmdc:mga03n38_288953_c1
336 nmdc:mga0yw44_463671_c1
337 nmdc:mga09592_88810_c1
338 nmdc:mga0qj67_284213_c1
339 nmdc:mga0n895_14648_c1
340 nmdc:mga0rr50_30116_c1
341 nmdc:mga0a205_69450_c1
342 Ga0495601_0317261
343 Ga0500644_0004068
344 Ga0500573_0077554
345 2585305779
346 2616701970
347 2644466720
348 2738722370
349 2739282734
350 2785366480
351 2786667536
352 2857538273
353 2862282227
354 2862390828
355 2877684051
356 2888583856
357 2889054453
358 2904758563
359 2918508412
360 2954673675
361 2954690314
362 2954700152
363 2954702076
364 2954718941
365 2954728911
366 2954732900
367 2954747810
368 2954751778
369 2954766935
370 3001268926
371 3001272212
372 3006991028
373 8008565019
374 8008581799

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

95

192

0.94

PF08241

Methyltransf_11

Methyltransferase domain

96

196

0.93

PF13847

Methyltransf_31

Methyltransferase domain

90

237

0.82

PF08242

Methyltransf_12

Methyltransferase domain

96

194

0.81

PF05175

MTS

Methyltransferase small domain

78

166

0.79

PF13489

Methyltransf_23

Methyltransferase domain

70

284

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.868 4 255
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.8647 4 255
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.8644 10 253
6m82-assembly1.cif.gz_A crystal structure of tylm1 y14paf bound to sah and dtdp-phenol 0.8609 10 253
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8505 22 150
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8765 31 150 3.40.50.150
af_I6Y1G8_11_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8564 31 153 3.40.50.150
af_A0A1D6NEM6_1_118_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8554 70 153 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8525 49 150 3.40.50.150
5himA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8493 18 252 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H5MVC6-F1-model_v4 Methyltransferase domain-containing protein 0.9904 1 252 GO:0008168
GO:0009058
GO:0032259
AF-A0A1H5MVC6-F1-model_v4 Methyltransferase domain-containing protein 0.9788 1 252 GO:0008168
GO:0009058
GO:0032259
AF-A0A1B2HZ24-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9685 18 254 GO:0003700
GO:0008168
GO:0043565
AF-A0A1B2HZ24-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9643 18 254 GO:0003700
GO:0008168
GO:0043565
AF-A0A7S8E8M4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9534 3 252 GO:0008168
GO:0032259

Map