F287909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 171 | 374 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10003682|Ga0307516_1000368218 |
| Length | 300 |
| Sequence | MRSIPGIDPLRPDAAGSYQAGQLHCRGRQLTSSVPPTGRRVDTHRSEPLVSMPDFYDDLAPLYHLIHQDWDASIRRQGEQLTALIKTEWPKSKRVLDVSCGIGTQAIGLAQHSYSVVGSDISANAVGRAEQEARVRGTKVLFAVCDMRQAHXXXGSGFDVVISCDNSLPHLLTDDDLLLALKEMLACLSAGGGCVISVRDYETEERGTNIVKSYGVRTERGKRYLIFQVWDFDGEQYDLAFFFVEEDLSSSKVKTHVMRSRYYAISITCLLELMRQAGFKNVRRLDHTFYQPVLVGTRTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 26 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 27 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 69 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 70 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 71 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 73 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 78 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 79 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 80 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 81 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 82 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 83 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 84 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 85 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 86 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 87 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 113 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 114 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 116 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 117 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 133 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 134 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 141 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 142 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 143 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 144 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 145 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 146 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 147 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 148 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 149 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 150 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 151 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 152 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 153 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 154 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 155 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 156 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 157 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 158 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 159 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 160 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 161 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 162 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 163 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 164 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 165 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 166 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 167 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 168 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 169 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 170 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 171 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.96 |
| Metatranscriptomes | 0 |
| Isolates | 16.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.88 |
| Nodule | 1.07 |
| Rhizoplane | 2.14 |
| Rhizosphere | 82.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307516_10003682 | 3300031730 | Bacteria | 19481 |
| 2 | rootH1_10134097 | 3300003316 | Bacteria | 1287 |
| 3 | rootL2_10362220 | 3300003322 | Bacteria | 1123 |
| 4 | rootH1_10050611 | 3300003323 | Bacteria | 2254 |
| 5 | Ga0055540_1000373 | 3300003792 | Bacteria | 37469 |
| 6 | Ga0065707_10122289 | 3300005295 | Bacteria | 2086 |
| 7 | Ga0070683_100403077 | 3300005329 | Bacteria | 1304 |
| 8 | Ga0070682_100071211 | 3300005337 | Bacteria | 2224 |
| 9 | Ga0070668_100294171 | 3300005347 | Bacteria | 1360 |
| 10 | Ga0070674_100366814 | 3300005356 | Bacteria | 1167 |
| 11 | Ga0070700_100417370 | 3300005441 | Unclassified | 1013 |
| 12 | Ga0070663_100161294 | 3300005455 | Bacteria | 1726 |
| 13 | Ga0070678_100244079 | 3300005456 | Bacteria | 1503 |
| 14 | Ga0070662_100100765 | 3300005457 | Bacteria | 2185 |
| 15 | Ga0070699_100714736 | 3300005518 | Unclassified | 916 |
| 16 | Ga0070684_100175695 | 3300005535 | Bacteria | 1946 |
| 17 | Ga0068853_100069235 | 3300005539 | Unclassified | 3069 |
| 18 | Ga0068857_100187072 | 3300005577 | Bacteria | 1885 |
| 19 | Ga0068856_100112347 | 3300005614 | Bacteria | 2722 |
| 20 | Ga0068852_100799029 | 3300005616 | Unclassified | 957 |
| 21 | Ga0068864_100099396 | 3300005618 | Bacteria | 2577 |
| 22 | Ga0068863_100052751 | 3300005841 | Bacteria | 3853 |
| 23 | Ga0068863_100081032 | 3300005841 | Bacteria | 3075 |
| 24 | Ga0081455_10080188 | 3300005937 | Bacteria | 2677 |
| 25 | Ga0081539_10026793 | 3300005985 | Bacteria | 3665 |
| 26 | Ga0075365_10017585 | 3300006038 | Bacteria | 4378 |
| 27 | Ga0075363_100176853 | 3300006048 | Bacteria | 1213 |
| 28 | Ga0097621_100039049 | 3300006237 | Bacteria | 3811 |
| 29 | Ga0068871_100004262 | 3300006358 | Bacteria | 9920 |
| 30 | Ga0075434_100005142 | 3300006871 | Bacteria | 11879 |
| 31 | Ga0075429_100093994 | 3300006880 | Bacteria | 2615 |
| 32 | Ga0075435_100093538 | 3300007076 | Bacteria | 2484 |
| 33 | Ga0105240_10015823 | 3300009093 | Bacteria | 10234 |
| 34 | Ga0105245_10386176 | 3300009098 | Bacteria | 1395 |
| 35 | Ga0114129_10105841 | 3300009147 | Bacteria | 3887 |
| 36 | Ga0114129_11264771 | 3300009147 | Bacteria | 916 |
| 37 | Ga0105243_10529220 | 3300009148 | Bacteria | 1122 |
| 38 | Ga0105241_10308279 | 3300009174 | Bacteria | 1361 |
| 39 | Ga0105242_10346221 | 3300009176 | Bacteria | 1371 |
| 40 | Ga0105237_10010778 | 3300009545 | Bacteria | 9702 |
| 41 | Ga0105238_10327279 | 3300009551 | Bacteria | 1519 |
| 42 | Ga0105249_10212524 | 3300009553 | Bacteria | 1899 |
| 43 | Ga0105249_10663720 | 3300009553 | Bacteria | 1101 |
| 44 | Ga0105239_10386057 | 3300010375 | Bacteria | 1584 |
| 45 | Ga0105239_10500829 | 3300010375 | Bacteria | 1381 |
| 46 | Ga0157369_10176822 | 3300013105 | Bacteria | 2247 |
| 47 | Ga0157378_10197266 | 3300013297 | Bacteria | 1902 |
| 48 | Ga0157372_10160302 | 3300013307 | Bacteria | 2600 |
| 49 | Ga0157375_10163750 | 3300013308 | Bacteria | 2368 |
| 50 | Ga0157380_10352614 | 3300014326 | Bacteria | 1377 |
| 51 | Ga0157380_10467270 | 3300014326 | Bacteria | 1216 |
| 52 | Ga0157379_10356561 | 3300014968 | Bacteria | 1340 |
| 53 | Ga0157376_10040742 | 3300014969 | Bacteria | 3798 |
| 54 | Ga0157376_10089879 | 3300014969 | Bacteria | 2656 |
| 55 | Ga0183367_1012 | 3300015688 | Bacteria | 347438 |
| 56 | Ga0163161_10455033 | 3300017792 | Bacteria | 1035 |
| 57 | Ga0209676_1000071 | 3300025292 | Bacteria | 309464 |
| 58 | Ga0207426_1014997 | 3300025302 | Bacteria | 2827 |
| 59 | Ga0209051_1000511 | 3300025303 | Bacteria | 49102 |
| 60 | Ga0209257_1002310 | 3300025304 | Bacteria | 19281 |
| 61 | Ga0207680_10467065 | 3300025903 | Bacteria | 897 |
| 62 | Ga0207695_10100286 | 3300025913 | Bacteria | 2892 |
| 63 | Ga0207690_10044028 | 3300025932 | Bacteria | 2940 |
| 64 | Ga0207706_10188595 | 3300025933 | Bacteria | 1810 |
| 65 | Ga0207689_10143831 | 3300025942 | Bacteria | 1965 |
| 66 | Ga0207679_10086759 | 3300025945 | Bacteria | 2408 |
| 67 | Ga0207712_10059065 | 3300025961 | Bacteria | 2713 |
| 68 | Ga0207668_10309046 | 3300025972 | Bacteria | 1308 |
| 69 | Ga0207708_10006803 | 3300026075 | Bacteria | 8457 |
| 70 | Ga0207702_10264875 | 3300026078 | Bacteria | 1619 |
| 71 | Ga0207641_10009108 | 3300026088 | Bacteria | 8200 |
| 72 | Ga0207641_10026468 | 3300026088 | Bacteria | 4787 |
| 73 | Ga0207676_10069069 | 3300026095 | Bacteria | 2828 |
| 74 | Ga0209982_1026212 | 3300027552 | Unclassified | 908 |
| 75 | Ga0307508_10022981 | 3300031616 | Bacteria | 5666 |
| 76 | Ga0316576_10315487 | 3300031727 | Unclassified | 1167 |
| 77 | Ga0307415_100331657 | 3300032126 | Bacteria | 1273 |
| 78 | Ga0373932_0066595 | 3300035112 | Unclassified | 1107 |
| 79 | Ga0373941_0010902 | 3300035115 | Bacteria | 2337 |
| 80 | Ga0373931_0029370 | 3300035691 | Bacteria | 2822 |
| 81 | Ga0395900_0000491 | 3300037418 | Bacteria | 55920 |
| 82 | Ga0395898_0004332 | 3300037466 | Bacteria | 15539 |
| 83 | Ga0395898_0029551 | 3300037466 | Bacteria | 5489 |
| 84 | Ga0395905_0000979 | 3300037471 | Bacteria | 36648 |
| 85 | Ga0436364_1237174 | 3300037853 | Bacteria | 1868 |
| 86 | Ga0436365_1225338 | 3300039437 | Bacteria | 13485 |
| 87 | Ga0436360_0949905 | 3300039438 | Bacteria | 4185 |
| 88 | Ga0439455_0002109 | 3300042012 | Bacteria | 3547 |
| 89 | Ga0450903_000054 | 3300042138 | Bacteria | 23481 |
| 90 | Ga0439458_0000021 | 3300042157 | Bacteria | 24267 |
| 91 | Ga0439458_0003807 | 3300042157 | Bacteria | 3490 |
| 92 | Ga0466972_0001188 | 3300044658 | Bacteria | 12511 |
| 93 | Ga0466965_0000125 | 3300044683 | Bacteria | 21878 |
| 94 | Ga0466968_0001769 | 3300044735 | Bacteria | 7787 |
| 95 | Ga0466967_0022577 | 3300045976 | Bacteria | 5138 |
| 96 | Ga0495627_073674 | 3300046453 | Bacteria | 995 |
| 97 | Ga0495592_0058732 | 3300046454 | Bacteria | 2836 |
| 98 | Ga0495603_0140496 | 3300046455 | Bacteria | 1405 |
| 99 | Ga0495662_0000182 | 3300046476 | Bacteria | 25321 |
| 100 | Ga0495608_0051190 | 3300046511 | Bacteria | 2738 |
| 101 | Ga0495628_0269951 | 3300046516 | Bacteria | 1266 |
| 102 | Ga0495630_0142663 | 3300046517 | Bacteria | 1821 |
| 103 | Ga0495666_0006854 | 3300046526 | Bacteria | 5720 |
| 104 | Ga0495640_0013937 | 3300046533 | Bacteria | 6100 |
| 105 | Ga0495586_0040698 | 3300046535 | Bacteria | 2501 |
| 106 | Ga0495587_0012955 | 3300046536 | Bacteria | 5242 |
| 107 | Ga0495634_0095938 | 3300046642 | Bacteria | 1920 |
| 108 | Ga0495611_0013837 | 3300046648 | Bacteria | 3440 |
| 109 | Ga0495599_0028147 | 3300046678 | Bacteria | 3521 |
| 110 | Ga0495646_0200609 | 3300046680 | Bacteria | 1086 |
| 111 | Ga0495669_0138981 | 3300046684 | Unclassified | 1146 |
| 112 | Ga0495613_0001201 | 3300046689 | Bacteria | 19778 |
| 113 | Ga0495613_0046395 | 3300046689 | Bacteria | 3213 |
| 114 | Ga0495600_0002754 | 3300046809 | Bacteria | 10186 |
| 115 | Ga0495600_0018747 | 3300046809 | Bacteria | 4413 |
| 116 | Ga0495604_0006488 | 3300047317 | Bacteria | 9271 |
| 117 | Ga0495604_0286994 | 3300047317 | Bacteria | 1110 |
| 118 | Ga0495676_0013938 | 3300047321 | Bacteria | 7205 |
| 119 | Ga0495676_0134594 | 3300047321 | Bacteria | 1779 |
| 120 | Ga0495676_0179668 | 3300047321 | Bacteria | 1484 |
| 121 | Ga0495683_0104825 | 3300047323 | Bacteria | 1356 |
| 122 | Ga0495687_055122 | 3300047443 | Bacteria | 1664 |
| 123 | Ga0495675_0075617 | 3300047444 | Bacteria | 2122 |
| 124 | Ga0495685_058920 | 3300047447 | Bacteria | 1296 |
| 125 | Ga0495593_0152567 | 3300047673 | Bacteria | 1168 |
| 126 | Ga0496104_0444475 | 3300048907 | Bacteria | 1208 |
| 127 | Ga0496107_0054663 | 3300048910 | Bacteria | 2882 |
| 128 | Ga0496108_0016118 | 3300048911 | Bacteria | 6092 |
| 129 | Ga0496110_0250747 | 3300048913 | Bacteria | 1611 |
| 130 | Ga0496123_0024596 | 3300048926 | Bacteria | 4573 |
| 131 | Ga0501033_0020913 | 3300049570 | Bacteria | 4939 |
| 132 | Ga0501034_0450787 | 3300049571 | Bacteria | 1204 |
| 133 | Ga0501036_0013005 | 3300049572 | Bacteria | 6910 |
| 134 | Ga0501036_0017403 | 3300049572 | Bacteria | 6008 |
| 135 | Ga0501038_0031051 | 3300049574 | Bacteria | 4723 |
| 136 | Ga0501039_0019117 | 3300049575 | Bacteria | 5256 |
| 137 | Ga0501043_0031130 | 3300049579 | Bacteria | 4195 |
| 138 | Ga0501068_0037070 | 3300049584 | Bacteria | 2919 |
| 139 | Ga0501069_0106495 | 3300049585 | Bacteria | 1594 |
| 140 | Ga0501070_0083000 | 3300049586 | Bacteria | 2652 |
| 141 | Ga0501073_0150826 | 3300049589 | Unclassified | 1611 |
| 142 | Ga0501074_0014962 | 3300049590 | Bacteria | 5645 |
| 143 | Ga0501076_0199115 | 3300049592 | Bacteria | 1635 |
| 144 | Ga0501077_0050153 | 3300049593 | Plasmid | 2653 |
| 145 | Ga0501079_0352567 | 3300049741 | Bacteria | 1153 |
| 146 | Ga0501035_0002069 | 3300049822 | Bacteria | 19967 |
| 147 | Ga0501035_0008510 | 3300049822 | Bacteria | 9554 |
| 148 | nmdc:mga03n38_288953_c1 | 3300050490 | Bacteria | 877 |
| 149 | nmdc:mga0yw44_463671_c1 | 3300050492 | Unclassified | 859 |
| 150 | nmdc:mga09592_88810_c1 | 3300050508 | Bacteria | 2640 |
| 151 | nmdc:mga0qj67_284213_c1 | 3300050509 | Bacteria | 1341 |
| 152 | nmdc:mga0n895_14648_c1 | 3300050512 | Bacteria | 7131 |
| 153 | nmdc:mga0rr50_30116_c1 | 3300050513 | Bacteria | 3838 |
| 154 | nmdc:mga0a205_69450_c1 | 3300050515 | Bacteria | 3401 |
| 155 | Ga0495601_0317261 | 3300053077 | Bacteria | 1015 |
| 156 | Ga0500644_0004068 | 3300053088 | Bacteria | 3638 |
| 157 | Ga0500573_0077554 | 3300053140 | Bacteria | 1891 |
| 158 | 2585305779 | 2582581313 | Bacteria | 10042643 |
| 159 | 2616701970 | 2616644814 | Bacteria | 11555299 |
| 160 | 2644466720 | 2643221683 | Bacteria | 5749203 |
| 161 | 2738722370 | 2738541277 | Bacteria | 7458140 |
| 162 | 2739282734 | 2738543019 | Bacteria | 7459457 |
| 163 | 2785366480 | 2784746768 | Bacteria | 10036182 |
| 164 | 2786667536 | 2786546132 | Bacteria | 10419719 |
| 165 | 2857538273 | 2857537821 | Bacteria | 5248181 |
| 166 | 2862282227 | 2862281513 | Bacteria | 9621493 |
| 167 | 2862390828 | 2862382967 | Bacteria | 10317375 |
| 168 | 2877684051 | 2877676314 | Bacteria | 9512378 |
| 169 | 2888583856 | 2888578766 | Bacteria | 6743310 |
| 170 | 2889054453 | 2889049205 | Bacteria | 7524325 |
| 171 | 2904758563 | 2904755435 | Bacteria | 7986759 |
| 172 | 2918508412 | 2918501144 | Bacteria | 8668083 |
| 173 | 2954673675 | 2954673503 | Bacteria | 9685905 |
| 174 | 2954690314 | 2954682443 | Bacteria | 9862841 |
| 175 | 2954700152 | 2954691527 | Bacteria | 10720516 |
| 176 | 2954702076 | 2954701450 | Bacteria | 10834262 |
| 177 | 2954718941 | 2954711539 | Bacteria | 10867210 |
| 178 | 2954728911 | 2954721474 | Bacteria | 10456478 |
| 179 | 2954732900 | 2954731030 | Bacteria | 10243860 |
| 180 | 2954747810 | 2954740390 | Bacteria | 10229294 |
| 181 | 2954751778 | 2954749733 | Bacteria | 10366972 |
| 182 | 2954766935 | 2954759201 | Bacteria | 9358192 |
| 183 | 3001268926 | 3001267043 | Bacteria | 4823521 |
| 184 | 3001272212 | 3001272096 | Bacteria | 4729684 |
| 185 | 3006991028 | 3006988479 | Bacteria | 4767936 |
| 186 | 8008565019 | 8008558824 | Bacteria | 10610750 |
| 187 | 8008581799 | 8008574985 | Bacteria | 7815457 |
| 188 | Ga0307516_10003682 | |||
| 189 | rootH1_10134097 | |||
| 190 | rootL2_10362220 | |||
| 191 | rootH1_10050611 | |||
| 192 | Ga0055540_1000373 | |||
| 193 | Ga0065707_10122289 | |||
| 194 | Ga0070683_100403077 | |||
| 195 | Ga0070682_100071211 | |||
| 196 | Ga0070668_100294171 | |||
| 197 | Ga0070674_100366814 | |||
| 198 | Ga0070700_100417370 | |||
| 199 | Ga0070663_100161294 | |||
| 200 | Ga0070678_100244079 | |||
| 201 | Ga0070662_100100765 | |||
| 202 | Ga0070699_100714736 | |||
| 203 | Ga0070684_100175695 | |||
| 204 | Ga0068853_100069235 | |||
| 205 | Ga0068857_100187072 | |||
| 206 | Ga0068856_100112347 | |||
| 207 | Ga0068852_100799029 | |||
| 208 | Ga0068864_100099396 | |||
| 209 | Ga0068863_100052751 | |||
| 210 | Ga0068863_100081032 | |||
| 211 | Ga0081455_10080188 | |||
| 212 | Ga0081539_10026793 | |||
| 213 | Ga0075365_10017585 | |||
| 214 | Ga0075363_100176853 | |||
| 215 | Ga0097621_100039049 | |||
| 216 | Ga0068871_100004262 | |||
| 217 | Ga0075434_100005142 | |||
| 218 | Ga0075429_100093994 | |||
| 219 | Ga0075435_100093538 | |||
| 220 | Ga0105240_10015823 | |||
| 221 | Ga0105245_10386176 | |||
| 222 | Ga0114129_10105841 | |||
| 223 | Ga0114129_11264771 | |||
| 224 | Ga0105243_10529220 | |||
| 225 | Ga0105241_10308279 | |||
| 226 | Ga0105242_10346221 | |||
| 227 | Ga0105237_10010778 | |||
| 228 | Ga0105238_10327279 | |||
| 229 | Ga0105249_10212524 | |||
| 230 | Ga0105249_10663720 | |||
| 231 | Ga0105239_10386057 | |||
| 232 | Ga0105239_10500829 | |||
| 233 | Ga0157369_10176822 | |||
| 234 | Ga0157378_10197266 | |||
| 235 | Ga0157372_10160302 | |||
| 236 | Ga0157375_10163750 | |||
| 237 | Ga0157380_10352614 | |||
| 238 | Ga0157380_10467270 | |||
| 239 | Ga0157379_10356561 | |||
| 240 | Ga0157376_10040742 | |||
| 241 | Ga0157376_10089879 | |||
| 242 | Ga0183367_1012 | |||
| 243 | Ga0163161_10455033 | |||
| 244 | Ga0209676_1000071 | |||
| 245 | Ga0207426_1014997 | |||
| 246 | Ga0209051_1000511 | |||
| 247 | Ga0209257_1002310 | |||
| 248 | Ga0207680_10467065 | |||
| 249 | Ga0207695_10100286 | |||
| 250 | Ga0207690_10044028 | |||
| 251 | Ga0207706_10188595 | |||
| 252 | Ga0207689_10143831 | |||
| 253 | Ga0207679_10086759 | |||
| 254 | Ga0207712_10059065 | |||
| 255 | Ga0207668_10309046 | |||
| 256 | Ga0207708_10006803 | |||
| 257 | Ga0207702_10264875 | |||
| 258 | Ga0207641_10009108 | |||
| 259 | Ga0207641_10026468 | |||
| 260 | Ga0207676_10069069 | |||
| 261 | Ga0209982_1026212 | |||
| 262 | Ga0307508_10022981 | |||
| 263 | Ga0316576_10315487 | |||
| 264 | Ga0307415_100331657 | |||
| 265 | Ga0373932_0066595 | |||
| 266 | Ga0373941_0010902 | |||
| 267 | Ga0373931_0029370 | |||
| 268 | Ga0395900_0000491 | |||
| 269 | Ga0395898_0004332 | |||
| 270 | Ga0395898_0029551 | |||
| 271 | Ga0395905_0000979 | |||
| 272 | Ga0436364_1237174 | |||
| 273 | Ga0436365_1225338 | |||
| 274 | Ga0436360_0949905 | |||
| 275 | Ga0439455_0002109 | |||
| 276 | Ga0450903_000054 | |||
| 277 | Ga0439458_0000021 | |||
| 278 | Ga0439458_0003807 | |||
| 279 | Ga0466972_0001188 | |||
| 280 | Ga0466965_0000125 | |||
| 281 | Ga0466968_0001769 | |||
| 282 | Ga0466967_0022577 | |||
| 283 | Ga0495627_073674 | |||
| 284 | Ga0495592_0058732 | |||
| 285 | Ga0495603_0140496 | |||
| 286 | Ga0495662_0000182 | |||
| 287 | Ga0495608_0051190 | |||
| 288 | Ga0495628_0269951 | |||
| 289 | Ga0495630_0142663 | |||
| 290 | Ga0495666_0006854 | |||
| 291 | Ga0495640_0013937 | |||
| 292 | Ga0495586_0040698 | |||
| 293 | Ga0495587_0012955 | |||
| 294 | Ga0495634_0095938 | |||
| 295 | Ga0495611_0013837 | |||
| 296 | Ga0495599_0028147 | |||
| 297 | Ga0495646_0200609 | |||
| 298 | Ga0495669_0138981 | |||
| 299 | Ga0495613_0001201 | |||
| 300 | Ga0495613_0046395 | |||
| 301 | Ga0495600_0002754 | |||
| 302 | Ga0495600_0018747 | |||
| 303 | Ga0495604_0006488 | |||
| 304 | Ga0495604_0286994 | |||
| 305 | Ga0495676_0013938 | |||
| 306 | Ga0495676_0134594 | |||
| 307 | Ga0495676_0179668 | |||
| 308 | Ga0495683_0104825 | |||
| 309 | Ga0495687_055122 | |||
| 310 | Ga0495675_0075617 | |||
| 311 | Ga0495685_058920 | |||
| 312 | Ga0495593_0152567 | |||
| 313 | Ga0496104_0444475 | |||
| 314 | Ga0496107_0054663 | |||
| 315 | Ga0496108_0016118 | |||
| 316 | Ga0496110_0250747 | |||
| 317 | Ga0496123_0024596 | |||
| 318 | Ga0501033_0020913 | |||
| 319 | Ga0501034_0450787 | |||
| 320 | Ga0501036_0013005 | |||
| 321 | Ga0501036_0017403 | |||
| 322 | Ga0501038_0031051 | |||
| 323 | Ga0501039_0019117 | |||
| 324 | Ga0501043_0031130 | |||
| 325 | Ga0501068_0037070 | |||
| 326 | Ga0501069_0106495 | |||
| 327 | Ga0501070_0083000 | |||
| 328 | Ga0501073_0150826 | |||
| 329 | Ga0501074_0014962 | |||
| 330 | Ga0501076_0199115 | |||
| 331 | Ga0501077_0050153 | |||
| 332 | Ga0501079_0352567 | |||
| 333 | Ga0501035_0002069 | |||
| 334 | Ga0501035_0008510 | |||
| 335 | nmdc:mga03n38_288953_c1 | |||
| 336 | nmdc:mga0yw44_463671_c1 | |||
| 337 | nmdc:mga09592_88810_c1 | |||
| 338 | nmdc:mga0qj67_284213_c1 | |||
| 339 | nmdc:mga0n895_14648_c1 | |||
| 340 | nmdc:mga0rr50_30116_c1 | |||
| 341 | nmdc:mga0a205_69450_c1 | |||
| 342 | Ga0495601_0317261 | |||
| 343 | Ga0500644_0004068 | |||
| 344 | Ga0500573_0077554 | |||
| 345 | 2585305779 | |||
| 346 | 2616701970 | |||
| 347 | 2644466720 | |||
| 348 | 2738722370 | |||
| 349 | 2739282734 | |||
| 350 | 2785366480 | |||
| 351 | 2786667536 | |||
| 352 | 2857538273 | |||
| 353 | 2862282227 | |||
| 354 | 2862390828 | |||
| 355 | 2877684051 | |||
| 356 | 2888583856 | |||
| 357 | 2889054453 | |||
| 358 | 2904758563 | |||
| 359 | 2918508412 | |||
| 360 | 2954673675 | |||
| 361 | 2954690314 | |||
| 362 | 2954700152 | |||
| 363 | 2954702076 | |||
| 364 | 2954718941 | |||
| 365 | 2954728911 | |||
| 366 | 2954732900 | |||
| 367 | 2954747810 | |||
| 368 | 2954751778 | |||
| 369 | 2954766935 | |||
| 370 | 3001268926 | |||
| 371 | 3001272212 | |||
| 372 | 3006991028 | |||
| 373 | 8008565019 | |||
| 374 | 8008581799 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wzn-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 | 0.868 | 4 | 255 |
| 1wzn-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 | 0.8647 | 4 | 255 |
| 6m83-assembly1.cif.gz_A-2 | crystal structure of tylm1 s120a bound to sah and dtdp-phenol | 0.8644 | 10 | 253 |
| 6m82-assembly1.cif.gz_A | crystal structure of tylm1 y14paf bound to sah and dtdp-phenol | 0.8609 | 10 | 253 |
| 3bus-assembly2.cif.gz_B | crystal structure of rebm | 0.8505 | 22 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8765 | 31 | 150 | 3.40.50.150 |
| af_I6Y1G8_11_226_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8564 | 31 | 153 | 3.40.50.150 |
| af_A0A1D6NEM6_1_118_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8554 | 70 | 153 | 3.40.50.150 |
| af_A0A1D6QMW6_179_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8525 | 49 | 150 | 3.40.50.150 |
| 5himA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8493 | 18 | 252 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5MVC6-F1-model_v4 | Methyltransferase domain-containing protein | 0.9904 | 1 | 252 |
GO:0008168
GO:0009058 GO:0032259 |
| AF-A0A1H5MVC6-F1-model_v4 | Methyltransferase domain-containing protein | 0.9788 | 1 | 252 |
GO:0008168
GO:0009058 GO:0032259 |
| AF-A0A1B2HZ24-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9685 | 18 | 254 |
GO:0003700
GO:0008168 GO:0043565 |
| AF-A0A1B2HZ24-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9643 | 18 | 254 |
GO:0003700
GO:0008168 GO:0043565 |
| AF-A0A7S8E8M4-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9534 | 3 | 252 |
GO:0008168
GO:0032259 |