F287563

General Info

Members Datasets Scaffolds Average Seq Length
187 162 374 275

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10214932|Ga0111539_102149323
Length 299
Sequence LQQCPCRFGTAADSWKNNNIEALVSTWLITGCSTGIGRALAEAVIAAGHNAVVTARDVTRVADLAETTPDRVLALALDVTNPEQIASAPRRAEERFAGIDVLVNNAGYGYRAAVEEGDDADVRTLFETHFFGTVAMIKAVLPGMRARRSGAIVNISSIGAQVTPVGSGYYAAAKSAIEGLSGALRGELAPLGISVIIVEPGAFRTDFAGRSLTQSAVVIDDYAATAGQRRKEHDTMHGNQSGDPVKAGTAIITAVESNEPPSFLLLGPDALAGYRYIADGRAEEISKWEQLSASTDLDS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
147 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
156 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
157 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
158 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
159 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
160 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
161 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
162 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 1.07
Rhizoplane 9.09
Rhizosphere 70.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10214932 3300009094 Bacteria 2240
2 rootH1_10112261 3300003316 Bacteria 1559
3 rootH2_10017588 3300003320 Bacteria 8270
4 rootH1_10061017 3300003323 Bacteria 2092
5 JGI25160J50197_1004312 3300003354 Bacteria 6165
6 JGI25161J50226_1002405 3300003374 Bacteria 4821
7 Ga0055543_1003030 3300004625 Bacteria 5188
8 Ga0065165_1004055 3300005262 Bacteria 9512
9 Ga0065165_1007756 3300005262 Bacteria 5188
10 Ga0070690_100142127 3300005330 Bacteria 1630
11 Ga0068869_100009466 3300005334 Bacteria 6322
12 Ga0070680_100021304 3300005336 Bacteria 5150
13 Ga0070682_100118111 3300005337 Bacteria 1776
14 Ga0068868_100045653 3300005338 Bacteria 3428
15 Ga0068868_100163339 3300005338 Bacteria 1841
16 Ga0070660_100268296 3300005339 Bacteria 1394
17 Ga0070675_100013573 3300005354 Bacteria 6406
18 Ga0070714_100384901 3300005435 Bacteria 1323
19 Ga0070713_100001660 3300005436 Bacteria 14298
20 Ga0070663_100005950 3300005455 Bacteria 7301
21 Ga0070678_100011405 3300005456 Bacteria 5481
22 Ga0070678_100116282 3300005456 Bacteria 2101
23 Ga0070662_100122553 3300005457 Bacteria 1994
24 Ga0070681_10022171 3300005458 Bacteria 6374
25 Ga0070684_100072768 3300005535 Bacteria 3027
26 Ga0068853_100014317 3300005539 Bacteria 6492
27 Ga0070693_100002076 3300005547 Bacteria 9168
28 Ga0068855_100563752 3300005563 Bacteria 1232
29 Ga0068856_100165095 3300005614 Bacteria 2225
30 Ga0068852_100018355 3300005616 Bacteria 5510
31 Ga0068852_100075688 3300005616 Bacteria 2970
32 Ga0068864_100199954 3300005618 Bacteria 1835
33 Ga0068863_100116553 3300005841 Bacteria 2545
34 Ga0068858_100148494 3300005842 Bacteria 2203
35 Ga0081455_10000157 3300005937 Bacteria 82320
36 Ga0081455_10007123 3300005937 Bacteria 11841
37 Ga0070717_10043486 3300006028 Bacteria 3667
38 Ga0070712_100144918 3300006175 Bacteria 1817
39 Ga0097621_100264250 3300006237 Bacteria 1510
40 Ga0105250_10050576 3300009092 Bacteria 1668
41 Ga0105245_10048790 3300009098 Bacteria 3788
42 Ga0105243_10087305 3300009148 Bacteria 2560
43 Ga0105243_10313030 3300009148 Bacteria 1427
44 Ga0105248_10031176 3300009177 Bacteria 5959
45 Ga0105237_10019291 3300009545 Bacteria 7044
46 Ga0105239_10023776 3300010375 Bacteria 6748
47 Ga0105239_10124613 3300010375 Bacteria 2863
48 Ga0105246_10416904 3300011119 Bacteria 1119
49 Ga0157373_10024658 3300013100 Bacteria 4356
50 Ga0157371_10034782 3300013102 Bacteria 3613
51 Ga0157374_10060763 3300013296 Bacteria 3537
52 Ga0157377_10045524 3300014745 Bacteria 2451
53 Ga0213876_10021342 3300021384 Bacteria 3425
54 Ga0207688_10284099 3300025901 Bacteria 1009
55 Ga0207647_10268568 3300025904 Bacteria 975
56 Ga0207699_10081187 3300025906 Bacteria 2011
57 Ga0207643_10000320 3300025908 Bacteria 33014
58 Ga0207654_10011531 3300025911 Bacteria 4511
59 Ga0207671_10126275 3300025914 Bacteria 1960
60 Ga0207693_10209370 3300025915 Bacteria 1533
61 Ga0207660_10105081 3300025917 Bacteria 2115
62 Ga0207657_10048030 3300025919 Bacteria 3728
63 Ga0207657_10226271 3300025919 Bacteria 1497
64 Ga0207649_10025160 3300025920 Bacteria 3468
65 Ga0207659_10086648 3300025926 Bacteria 2329
66 Ga0207687_10204625 3300025927 Bacteria 1545
67 Ga0207700_10072341 3300025928 Bacteria 2658
68 Ga0207664_10127309 3300025929 Bacteria 2140
69 Ga0207690_10020389 3300025932 Bacteria 4096
70 Ga0207690_10117382 3300025932 Bacteria 1926
71 Ga0207706_10220585 3300025933 Bacteria 1660
72 Ga0207709_10274595 3300025935 Bacteria 1242
73 Ga0207711_10056160 3300025941 Bacteria 3382
74 Ga0207689_10018038 3300025942 Bacteria 5960
75 Ga0207661_10009547 3300025944 Bacteria 6964
76 Ga0207679_10006069 3300025945 Bacteria 7617
77 Ga0207712_10033756 3300025961 Bacteria 3461
78 Ga0207677_10030339 3300026023 Bacteria 3450
79 Ga0207703_10016168 3300026035 Bacteria 5816
80 Ga0207639_10019525 3300026041 Bacteria 4836
81 Ga0207678_10000094 3300026067 Bacteria 74360
82 Ga0207702_10013617 3300026078 Bacteria 6755
83 Ga0207641_10263278 3300026088 Bacteria 1615
84 Ga0207683_10040447 3300026121 Bacteria 4068
85 Ga0207698_10648364 3300026142 Bacteria 1046
86 Ga0207428_10304897 3300027907 Bacteria 1178
87 Ga0268264_10187391 3300028381 Bacteria 1883
88 Ga0307511_10117334 3300030521 Bacteria 1663
89 Ga0307408_100560877 3300031548 Bacteria 1009
90 Ga0307508_10008882 3300031616 Bacteria 9262
91 Ga0307508_10139185 3300031616 Bacteria 2031
92 Ga0307516_10001035 3300031730 Bacteria 38669
93 Ga0307413_10102201 3300031824 Bacteria 1897
94 Ga0307410_10026094 3300031852 Bacteria 3673
95 Ga0307412_10032809 3300031911 Bacteria 3295
96 Ga0307409_100405427 3300031995 Bacteria 1303
97 Ga0307414_10062094 3300032004 Bacteria 2650
98 Ga0307414_10353927 3300032004 Bacteria 1261
99 Ga0307411_10032898 3300032005 Bacteria 3210
100 Ga0307415_100021833 3300032126 Bacteria 3942
101 Ga0373926_0105095 3300035083 Bacteria 1058
102 Ga0373927_0005510 3300035695 Bacteria 8720
103 Ga0373947_0094085 3300035725 Bacteria 1874
104 Ga0436365_0152461 3300039437 Bacteria 40083
105 Ga0466966_0152296 3300044684 Bacteria 1410
106 Ga0466961_0089716 3300044693 Bacteria 1941
107 Ga0466963_0052824 3300044694 Bacteria 2697
108 Ga0466959_0143701 3300045049 Bacteria 1685
109 Ga0466967_0231218 3300045976 Bacteria 1760
110 Ga0495638_0006729 3300046460 Bacteria 8326
111 Ga0495653_0271370 3300046463 Bacteria 1117
112 Ga0495585_0038947 3300046492 Bacteria 2674
113 Ga0495585_0066754 3300046492 Bacteria 1969
114 Ga0495606_0235622 3300046507 Bacteria 1023
115 Ga0495610_0087071 3300046512 Bacteria 1422
116 Ga0495631_0001470 3300046518 Bacteria 14298
117 Ga0495632_0011079 3300046519 Bacteria 5284
118 Ga0495648_0002167 3300046524 Bacteria 18488
119 Ga0495633_0010098 3300046558 Bacteria 5172
120 Ga0495656_0022238 3300046615 Bacteria 2481
121 Ga0495668_0058810 3300046616 Bacteria 2121
122 Ga0495625_0007316 3300046660 Bacteria 9646
123 Ga0495670_0192067 3300046691 Bacteria 1080
124 Ga0495660_0069676 3300046810 Bacteria 1869
125 Ga0495672_0008808 3300047320 Bacteria 7388
126 Ga0495673_0001217 3300047469 Bacteria 21393
127 Ga0495686_0002145 3300047472 Bacteria 19292
128 Ga0495686_0014694 3300047472 Bacteria 5382
129 Ga0496102_0079920 3300048905 Bacteria 3012
130 Ga0496102_0469475 3300048905 Bacteria 1179
131 Ga0496104_0025893 3300048907 Bacteria 5410
132 Ga0496105_0009355 3300048908 Bacteria 7660
133 Ga0496106_0000374 3300048909 Bacteria 31782
134 Ga0496106_0030080 3300048909 Bacteria 4049
135 Ga0496108_0128131 3300048911 Bacteria 2180
136 Ga0496108_0200801 3300048911 Bacteria 1730
137 Ga0496108_0219552 3300048911 Bacteria 1652
138 Ga0496109_0018717 3300048912 Bacteria 6089
139 Ga0496109_0141096 3300048912 Bacteria 2253
140 Ga0496110_0130643 3300048913 Bacteria 2268
141 Ga0496111_0039918 3300048914 Bacteria 3367
142 Ga0496112_0025875 3300048915 Bacteria 5639
143 Ga0496113_0040122 3300048916 Bacteria 3448
144 Ga0496113_0253252 3300048916 Bacteria 1406
145 Ga0496114_0219509 3300048917 Bacteria 1669
146 Ga0496117_0065846 3300048920 Bacteria 2461
147 Ga0496118_0000538 3300048921 Bacteria 62335
148 Ga0496118_0003745 3300048921 Bacteria 18802
149 Ga0496121_0000685 3300048924 Bacteria 63117
150 Ga0496124_0000974 3300048927 Bacteria 45559
151 Ga0496125_0102842 3300048928 Bacteria 2098
152 Ga0496126_0003665 3300048929 Bacteria 19182
153 Ga0496126_0128809 3300048929 Bacteria 2189
154 Ga0495678_000216 3300049459 Bacteria 66661
155 Ga0495678_049936 3300049459 Bacteria 1624
156 Ga0501031_0017186 3300049568 Bacteria 4700
157 Ga0501032_0000526 3300049569 Bacteria 31167
158 Ga0501037_0037705 3300049573 Bacteria 3563
159 Ga0501037_0201980 3300049573 Bacteria 1404
160 Ga0501038_0135454 3300049574 Bacteria 2018
161 Ga0501038_0171575 3300049574 Bacteria 1755
162 Ga0501039_0001026 3300049575 Bacteria 20381
163 Ga0501043_0091869 3300049579 Bacteria 2386
164 Ga0501070_0274994 3300049586 Bacteria 1375
165 nmdc:mga08y16_22589_c1 3300050511 Bacteria 6642
166 nmdc:mga08x19_103558_c1 3300050514 Bacteria 1891
167 Ga0500643_001819 3300053087 Bacteria 11666
168 Ga0500644_0034049 3300053088 Bacteria 1641
169 Ga0500556_0000100 3300053104 Bacteria 78417
170 Ga0500557_005535 3300053105 Bacteria 2775
171 Ga0500569_000290 3300053109 Bacteria 7988
172 Ga0500594_0056837 3300053118 Bacteria 1117
173 Ga0500595_066925 3300053119 Bacteria 1073
174 Ga0500568_0000100 3300053139 Bacteria 78717
175 Ga0500573_0089445 3300053140 Bacteria 1741
176 Ga0500573_0143855 3300053140 Bacteria 1311
177 Ga0500588_0018711 3300053146 Bacteria 1830
178 Ga0500636_0009867 3300053177 Bacteria 5560
179 Ga0466962_0038965 3300061719 Bacteria 2276
180 2511195576 2510917030 Bacteria 7460662
181 2644238932 2643221643 Bacteria 5749658
182 2689995624 2687453743 Bacteria 8361025
183 2731907521 2731639228 Bacteria 4187555
184 2852393252 2852387548 Bacteria 8025568
185 2945959102 2945956166 Bacteria 5110334
186 2946061582 2946059875 Bacteria 4386623
187 8054708871 8054704163 Bacteria 7247792
188 Ga0111539_10214932
189 rootH1_10112261
190 rootH2_10017588
191 rootH1_10061017
192 JGI25160J50197_1004312
193 JGI25161J50226_1002405
194 Ga0055543_1003030
195 Ga0065165_1004055
196 Ga0065165_1007756
197 Ga0070690_100142127
198 Ga0068869_100009466
199 Ga0070680_100021304
200 Ga0070682_100118111
201 Ga0068868_100045653
202 Ga0068868_100163339
203 Ga0070660_100268296
204 Ga0070675_100013573
205 Ga0070714_100384901
206 Ga0070713_100001660
207 Ga0070663_100005950
208 Ga0070678_100011405
209 Ga0070678_100116282
210 Ga0070662_100122553
211 Ga0070681_10022171
212 Ga0070684_100072768
213 Ga0068853_100014317
214 Ga0070693_100002076
215 Ga0068855_100563752
216 Ga0068856_100165095
217 Ga0068852_100018355
218 Ga0068852_100075688
219 Ga0068864_100199954
220 Ga0068863_100116553
221 Ga0068858_100148494
222 Ga0081455_10000157
223 Ga0081455_10007123
224 Ga0070717_10043486
225 Ga0070712_100144918
226 Ga0097621_100264250
227 Ga0105250_10050576
228 Ga0105245_10048790
229 Ga0105243_10087305
230 Ga0105243_10313030
231 Ga0105248_10031176
232 Ga0105237_10019291
233 Ga0105239_10023776
234 Ga0105239_10124613
235 Ga0105246_10416904
236 Ga0157373_10024658
237 Ga0157371_10034782
238 Ga0157374_10060763
239 Ga0157377_10045524
240 Ga0213876_10021342
241 Ga0207688_10284099
242 Ga0207647_10268568
243 Ga0207699_10081187
244 Ga0207643_10000320
245 Ga0207654_10011531
246 Ga0207671_10126275
247 Ga0207693_10209370
248 Ga0207660_10105081
249 Ga0207657_10048030
250 Ga0207657_10226271
251 Ga0207649_10025160
252 Ga0207659_10086648
253 Ga0207687_10204625
254 Ga0207700_10072341
255 Ga0207664_10127309
256 Ga0207690_10020389
257 Ga0207690_10117382
258 Ga0207706_10220585
259 Ga0207709_10274595
260 Ga0207711_10056160
261 Ga0207689_10018038
262 Ga0207661_10009547
263 Ga0207679_10006069
264 Ga0207712_10033756
265 Ga0207677_10030339
266 Ga0207703_10016168
267 Ga0207639_10019525
268 Ga0207678_10000094
269 Ga0207702_10013617
270 Ga0207641_10263278
271 Ga0207683_10040447
272 Ga0207698_10648364
273 Ga0207428_10304897
274 Ga0268264_10187391
275 Ga0307511_10117334
276 Ga0307408_100560877
277 Ga0307508_10008882
278 Ga0307508_10139185
279 Ga0307516_10001035
280 Ga0307413_10102201
281 Ga0307410_10026094
282 Ga0307412_10032809
283 Ga0307409_100405427
284 Ga0307414_10062094
285 Ga0307414_10353927
286 Ga0307411_10032898
287 Ga0307415_100021833
288 Ga0373926_0105095
289 Ga0373927_0005510
290 Ga0373947_0094085
291 Ga0436365_0152461
292 Ga0466966_0152296
293 Ga0466961_0089716
294 Ga0466963_0052824
295 Ga0466959_0143701
296 Ga0466967_0231218
297 Ga0495638_0006729
298 Ga0495653_0271370
299 Ga0495585_0038947
300 Ga0495585_0066754
301 Ga0495606_0235622
302 Ga0495610_0087071
303 Ga0495631_0001470
304 Ga0495632_0011079
305 Ga0495648_0002167
306 Ga0495633_0010098
307 Ga0495656_0022238
308 Ga0495668_0058810
309 Ga0495625_0007316
310 Ga0495670_0192067
311 Ga0495660_0069676
312 Ga0495672_0008808
313 Ga0495673_0001217
314 Ga0495686_0002145
315 Ga0495686_0014694
316 Ga0496102_0079920
317 Ga0496102_0469475
318 Ga0496104_0025893
319 Ga0496105_0009355
320 Ga0496106_0000374
321 Ga0496106_0030080
322 Ga0496108_0128131
323 Ga0496108_0200801
324 Ga0496108_0219552
325 Ga0496109_0018717
326 Ga0496109_0141096
327 Ga0496110_0130643
328 Ga0496111_0039918
329 Ga0496112_0025875
330 Ga0496113_0040122
331 Ga0496113_0253252
332 Ga0496114_0219509
333 Ga0496117_0065846
334 Ga0496118_0000538
335 Ga0496118_0003745
336 Ga0496121_0000685
337 Ga0496124_0000974
338 Ga0496125_0102842
339 Ga0496126_0003665
340 Ga0496126_0128809
341 Ga0495678_000216
342 Ga0495678_049936
343 Ga0501031_0017186
344 Ga0501032_0000526
345 Ga0501037_0037705
346 Ga0501037_0201980
347 Ga0501038_0135454
348 Ga0501038_0171575
349 Ga0501039_0001026
350 Ga0501043_0091869
351 Ga0501070_0274994
352 nmdc:mga08y16_22589_c1
353 nmdc:mga08x19_103558_c1
354 Ga0500643_001819
355 Ga0500644_0034049
356 Ga0500556_0000100
357 Ga0500557_005535
358 Ga0500569_000290
359 Ga0500594_0056837
360 Ga0500595_066925
361 Ga0500568_0000100
362 Ga0500573_0089445
363 Ga0500573_0143855
364 Ga0500588_0018711
365 Ga0500636_0009867
366 Ga0466962_0038965
367 2511195576
368 2644238932
369 2689995624
370 2731907521
371 2852393252
372 2945959102
373 2946061582
374 8054708871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

216

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

31

234

0.9

PF08659

KR

KR domain

25

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9582 2 177
5jy1-assembly1.cif.gz_D crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 bound to nad 0.9553 2 177
6zzo-assembly1.cif.gz_A-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.952 2 178
6zzo-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9514 2 178
6zzp-assembly1.cif.gz_B-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9506 2 178
ID Description Score Start End Superfamily
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 2 177 3.40.50.720
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 2 178 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 2 161 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.94 2 177 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 2 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y8VGN1-F1-model_v4 deleted 0.9826 1 179
AF-A0A0N7Z5W0-F1-model_v4 Dehydrogenase 0.9783 2 178 GO:0016491
AF-A0A3A6RLM2-F1-model_v4 deleted 0.9723 2 179
AF-A0A3L6ZWG0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9689 1 274 GO:0003677
GO:0016491
AF-A0A3C1NUD4-F1-model_v4 deleted 0.9688 2 203

Map