F287451

General Info

Members Datasets Scaffolds Average Seq Length
187 128 374 408

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100079253|Ga0070712_1000792532
Length 460
Sequence VKLAVSWATGLKAWPRPESIRDYVAASTPLGMTVMRFGLTFHLNMRLVVQKYGGTSVGTPERICHVAQRILETQRQGCRVVAVVSAMAGVTDELVRLGHAVATQPTKRELDIVLSTGEQAAAALTAMAVNGLGGTAISLTGAQAGILTDRNHTRARIANISPKQIHELLADDYIVIVAGFQGQTPEGETTTLGRGGSDLTAIALAGALNADTCQIFTDVDGVFTCDPRIVKDAEKLGEIAYDELLEMAGSGAKVMQSRAVEFAKKFGVEFEVRSTFKEVPGTVTREETPSMEDILIRGISLDRHQAKLSIAGARDKPGIVARIFSDIGAAHIIVDMIVQNASIDGTTDISFTIHEDELENARTILMPVLGELGAKRLNTASGVAKLSVVGIGMRSHSGVAARLFACLGRAGINIQMVSTSEIKIAVIIDEKEAERAAGLIHAEFGLGRLLPADAATQPLA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
126 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 2.67
Rhizosphere 92.51
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100079253 3300006175 Unclassified 2373
2 JGI25406J46586_10000003 3300003203 Bacteria 161718
3 Ga0070666_10046510 3300005335 Bacteria 2911
4 Ga0070689_100019611 3300005340 Bacteria 5002
5 Ga0070689_100209668 3300005340 Bacteria 1594
6 Ga0070668_100015366 3300005347 Bacteria 5721
7 Ga0070669_100053725 3300005353 Bacteria 2949
8 Ga0070671_100050268 3300005355 Unclassified 3467
9 Ga0070674_100041805 3300005356 Bacteria 3110
10 Ga0070673_100021482 3300005364 Bacteria 4681
11 Ga0070673_100082431 3300005364 Bacteria 2611
12 Ga0070659_100068887 3300005366 Unclassified 2808
13 Ga0070667_100050320 3300005367 Bacteria 3511
14 Ga0070713_100024453 3300005436 Bacteria 4705
15 Ga0070701_10020775 3300005438 Bacteria 3122
16 Ga0070711_100013410 3300005439 Bacteria 5148
17 Ga0070708_100138575 3300005445 Bacteria 2255
18 Ga0070681_10028245 3300005458 Bacteria 5639
19 Ga0070706_100003034 3300005467 Bacteria 16626
20 Ga0070706_100035642 3300005467 Bacteria 4593
21 Ga0070706_100093027 3300005467 Unclassified 2797
22 Ga0070706_100138278 3300005467 Unclassified 2273
23 Ga0070707_100021462 3300005468 Bacteria 6104
24 Ga0070707_100039401 3300005468 Bacteria 4516
25 Ga0070707_100215794 3300005468 Bacteria 1870
26 Ga0070698_100016083 3300005471 Bacteria 7899
27 Ga0070698_100033629 3300005471 Bacteria 5311
28 Ga0070698_100049795 3300005471 Bacteria 4275
29 Ga0070698_100058373 3300005471 Bacteria 3901
30 Ga0070698_100214408 3300005471 Bacteria 1859
31 Ga0070684_100021856 3300005535 Bacteria 5330
32 Ga0070697_100005395 3300005536 Bacteria 9842
33 Ga0070697_100039763 3300005536 Unclassified 3804
34 Ga0070697_100041847 3300005536 Bacteria 3709
35 Ga0070697_100107219 3300005536 Bacteria 2324
36 Ga0070697_100163297 3300005536 Bacteria 1882
37 Ga0070686_100027271 3300005544 Bacteria 3456
38 Ga0070665_100029219 3300005548 Bacteria 5548
39 Ga0070665_100073857 3300005548 Unclassified 3416
40 Ga0070704_100210488 3300005549 Bacteria 1575
41 Ga0068854_100070157 3300005578 Bacteria 2561
42 Ga0068852_100122385 3300005616 Bacteria 2385
43 Ga0068859_100329088 3300005617 Bacteria 1622
44 Ga0068863_100172084 3300005841 Bacteria 2077
45 Ga0068858_100009816 3300005842 Bacteria 9108
46 Ga0081455_10000344 3300005937 Bacteria 60785
47 Ga0081455_10125510 3300005937 Bacteria 2015
48 Ga0081539_10000077 3300005985 Bacteria 228125
49 Ga0081539_10003550 3300005985 Bacteria 18946
50 Ga0081539_10010975 3300005985 Bacteria 7257
51 Ga0070717_10010123 3300006028 Bacteria 7100
52 Ga0070717_10011957 3300006028 Bacteria 6605
53 Ga0070716_100090577 3300006173 Bacteria 1850
54 Ga0075362_10009773 3300006177 Bacteria 3721
55 Ga0097620_100329138 3300006931 Bacteria 1622
56 Ga0105240_10000412 3300009093 Bacteria 79783
57 Ga0105240_10253713 3300009093 Bacteria 2033
58 Ga0111539_10017432 3300009094 Bacteria 8892
59 Ga0111539_10326915 3300009094 Bacteria 1785
60 Ga0114129_10199524 3300009147 Bacteria 2711
61 Ga0105241_10289215 3300009174 Unclassified 1402
62 Ga0105242_10017027 3300009176 Bacteria 5659
63 Ga0105248_10068945 3300009177 Bacteria 3970
64 Ga0105248_10269220 3300009177 Bacteria 1918
65 Ga0105238_10035877 3300009551 Bacteria 5041
66 Ga0105249_10031561 3300009553 Bacteria 4791
67 Ga0157374_10039561 3300013296 Bacteria 4339
68 Ga0157374_10133389 3300013296 Bacteria 2405
69 Ga0157378_10340449 3300013297 Bacteria 1462
70 Ga0163162_10153568 3300013306 Bacteria 2421
71 Ga0163162_10193046 3300013306 Bacteria 2164
72 Ga0157372_10085660 3300013307 Bacteria 3574
73 Ga0157372_10101210 3300013307 Bacteria 3289
74 Ga0157375_10001984 3300013308 Bacteria 17675
75 Ga0157375_10076121 3300013308 Bacteria 3382
76 Ga0163163_10102748 3300014325 Bacteria 2882
77 Ga0163163_10379736 3300014325 Bacteria 1471
78 Ga0157379_10058601 3300014968 Unclassified 3444
79 Ga0157376_10018114 3300014969 Bacteria 5389
80 Ga0157376_10261386 3300014969 Bacteria 1622
81 Ga0213872_10031221 3300021361 Bacteria 2441
82 Ga0213872_10057184 3300021361 Bacteria 1766
83 Ga0213876_10009748 3300021384 Bacteria 5168
84 Ga0213871_10005880 3300021441 Bacteria 2564
85 Ga0207673_1002738 3300025290 Bacteria 2027
86 Ga0207697_10002401 3300025315 Bacteria 9760
87 Ga0207697_10006218 3300025315 Bacteria 5428
88 Ga0207697_10007813 3300025315 Bacteria 4735
89 Ga0207697_10018670 3300025315 Bacteria 2843
90 Ga0207680_10033701 3300025903 Bacteria 2924
91 Ga0207647_10017443 3300025904 Bacteria 4879
92 Ga0207645_10000820 3300025907 Bacteria 26050
93 Ga0207684_10000411 3300025910 Bacteria 57343
94 Ga0207684_10003502 3300025910 Bacteria 15315
95 Ga0207684_10014689 3300025910 Bacteria 6746
96 Ga0207684_10023723 3300025910 Bacteria 5235
97 Ga0207684_10046646 3300025910 Unclassified 3676
98 Ga0207684_10092486 3300025910 Bacteria 2578
99 Ga0207695_10000208 3300025913 Bacteria 158591
100 Ga0207693_10030396 3300025915 Bacteria 4265
101 Ga0207693_10044597 3300025915 Bacteria 3485
102 Ga0207693_10057676 3300025915 Unclassified 3043
103 Ga0207693_10194921 3300025915 Bacteria 1594
104 Ga0207663_10040491 3300025916 Bacteria 2832
105 Ga0207657_10128059 3300025919 Unclassified 2083
106 Ga0207646_10000364 3300025922 Bacteria 60964
107 Ga0207646_10012278 3300025922 Bacteria 8239
108 Ga0207646_10052333 3300025922 Bacteria 3654
109 Ga0207681_10068291 3300025923 Bacteria 2468
110 Ga0207650_10058327 3300025925 Bacteria 2874
111 Ga0207700_10022409 3300025928 Bacteria 4335
112 Ga0207706_10021171 3300025933 Bacteria 5843
113 Ga0207670_10049981 3300025936 Bacteria 2799
114 Ga0207665_10228489 3300025939 Bacteria 1367
115 Ga0207711_10024794 3300025941 Bacteria 5031
116 Ga0207689_10158658 3300025942 Unclassified 1864
117 Ga0207689_10242467 3300025942 Bacteria 1490
118 Ga0207667_10013563 3300025949 Bacteria 9316
119 Ga0207667_10035875 3300025949 Bacteria 5319
120 Ga0207703_10094655 3300026035 Bacteria 2519
121 Ga0207678_10023985 3300026067 Bacteria 5333
122 Ga0207641_10130514 3300026088 Bacteria 2256
123 Ga0207683_10138727 3300026121 Bacteria 2190
124 Ga0207698_10105151 3300026142 Bacteria 2351
125 Ga0207428_10063457 3300027907 Bacteria 2918
126 Ga0268264_10013184 3300028381 Bacteria 6801
127 Ga0265326_10013421 3300028558 Bacteria 2397
128 Ga0265338_10060895 3300028800 Bacteria 3311
129 Ga0265320_10002782 3300031240 Bacteria 12054
130 Ga0265325_10079089 3300031241 Bacteria 1637
131 Ga0373935_0014437 3300035692 Bacteria 4766
132 Ga0373935_0036280 3300035692 Bacteria 3082
133 Ga0395900_0002411 3300037418 Bacteria 20621
134 Ga0395898_0002152 3300037466 Bacteria 24211
135 Ga0395905_0022441 3300037471 Bacteria 5969
136 Ga0395901_0023650 3300038443 Bacteria 6299
137 Ga0436365_0403615 3300039437 Bacteria 23583
138 Ga0436360_0311136 3300039438 Unclassified 2882
139 Ga0436361_0600172 3300039447 Bacteria 5209
140 Ga0436361_0762764 3300039447 Bacteria 4412
141 Ga0436361_0982820 3300039447 Bacteria 7705
142 Ga0436363_0433830 3300039450 Bacteria 5682
143 Ga0436363_0632505 3300039450 Bacteria 13321
144 Ga0453684_0046375 3300044712 Bacteria 5781
145 Ga0453684_0576598 3300044712 Bacteria 1236
146 Ga0495592_0000054 3300046454 Bacteria 107373
147 Ga0495608_0081231 3300046511 Bacteria 2107
148 Ga0495618_0030765 3300046514 Bacteria 3354
149 Ga0495628_0000241 3300046516 Bacteria 48162
150 Ga0495628_0031297 3300046516 Unclassified 4304
151 Ga0495630_0004601 3300046517 Bacteria 9671
152 Ga0495630_0080809 3300046517 Bacteria 2453
153 Ga0495643_0000057 3300046522 Bacteria 195145
154 Ga0495666_0019581 3300046526 Bacteria 3357
155 Ga0495640_0009994 3300046533 Bacteria 7357
156 Ga0495640_0091282 3300046533 Bacteria 2010
157 Ga0495640_0164101 3300046533 Bacteria 1422
158 Ga0495586_0002972 3300046535 Bacteria 9136
159 Ga0495586_0057477 3300046535 Bacteria 2111
160 Ga0495645_0013301 3300046543 Bacteria 5817
161 Ga0495634_0060496 3300046642 Bacteria 2520
162 Ga0495634_0147088 3300046642 Unclassified 1492
163 Ga0495599_0002097 3300046678 Bacteria 11577
164 Ga0495599_0011824 3300046678 Bacteria 5367
165 Ga0495658_0109699 3300046683 Bacteria 1658
166 Ga0495624_0037331 3300046690 Bacteria 3127
167 Ga0495624_0141445 3300046690 Bacteria 1474
168 Ga0495581_0045509 3300047315 Bacteria 2537
169 Ga0495674_0022696 3300047319 Bacteria 5785
170 Ga0495674_0088634 3300047319 Bacteria 2646
171 Ga0495675_0162422 3300047444 Bacteria 1375
172 Ga0495684_0003382 3300047471 Bacteria 12524
173 Ga0496101_0065050 3300048904 Unclassified 2658
174 Ga0496106_0050470 3300048909 Unclassified 3136
175 Ga0496111_0170207 3300048914 Bacteria 1619
176 Ga0496114_0053991 3300048917 Unclassified 3350
177 Ga0496115_0025956 3300048918 Unclassified 4567
178 Ga0501034_0245707 3300049571 Bacteria 1735
179 nmdc:mga03n38_3726_c1 3300050490 Bacteria 4936
180 nmdc:mga0k408_22017_c1 3300050493 Bacteria 3586
181 nmdc:mga05p37_91173_c1 3300050507 Bacteria 3755
182 nmdc:mga08y16_41343_c1 3300050511 Bacteria 4829
183 nmdc:mga08x19_186305_c1 3300050514 Bacteria 1418
184 Ga0495612_0067134 3300053078 Bacteria 1492
185 Ga0500555_004056 3300053103 Bacteria 4162
186 Ga0500556_0000302 3300053104 Bacteria 37670
187 2916974519 2916971899 Bacteria 4250608
188 Ga0070712_100079253
189 JGI25406J46586_10000003
190 Ga0070666_10046510
191 Ga0070689_100019611
192 Ga0070689_100209668
193 Ga0070668_100015366
194 Ga0070669_100053725
195 Ga0070671_100050268
196 Ga0070674_100041805
197 Ga0070673_100021482
198 Ga0070673_100082431
199 Ga0070659_100068887
200 Ga0070667_100050320
201 Ga0070713_100024453
202 Ga0070701_10020775
203 Ga0070711_100013410
204 Ga0070708_100138575
205 Ga0070681_10028245
206 Ga0070706_100003034
207 Ga0070706_100035642
208 Ga0070706_100093027
209 Ga0070706_100138278
210 Ga0070707_100021462
211 Ga0070707_100039401
212 Ga0070707_100215794
213 Ga0070698_100016083
214 Ga0070698_100033629
215 Ga0070698_100049795
216 Ga0070698_100058373
217 Ga0070698_100214408
218 Ga0070684_100021856
219 Ga0070697_100005395
220 Ga0070697_100039763
221 Ga0070697_100041847
222 Ga0070697_100107219
223 Ga0070697_100163297
224 Ga0070686_100027271
225 Ga0070665_100029219
226 Ga0070665_100073857
227 Ga0070704_100210488
228 Ga0068854_100070157
229 Ga0068852_100122385
230 Ga0068859_100329088
231 Ga0068863_100172084
232 Ga0068858_100009816
233 Ga0081455_10000344
234 Ga0081455_10125510
235 Ga0081539_10000077
236 Ga0081539_10003550
237 Ga0081539_10010975
238 Ga0070717_10010123
239 Ga0070717_10011957
240 Ga0070716_100090577
241 Ga0075362_10009773
242 Ga0097620_100329138
243 Ga0105240_10000412
244 Ga0105240_10253713
245 Ga0111539_10017432
246 Ga0111539_10326915
247 Ga0114129_10199524
248 Ga0105241_10289215
249 Ga0105242_10017027
250 Ga0105248_10068945
251 Ga0105248_10269220
252 Ga0105238_10035877
253 Ga0105249_10031561
254 Ga0157374_10039561
255 Ga0157374_10133389
256 Ga0157378_10340449
257 Ga0163162_10153568
258 Ga0163162_10193046
259 Ga0157372_10085660
260 Ga0157372_10101210
261 Ga0157375_10001984
262 Ga0157375_10076121
263 Ga0163163_10102748
264 Ga0163163_10379736
265 Ga0157379_10058601
266 Ga0157376_10018114
267 Ga0157376_10261386
268 Ga0213872_10031221
269 Ga0213872_10057184
270 Ga0213876_10009748
271 Ga0213871_10005880
272 Ga0207673_1002738
273 Ga0207697_10002401
274 Ga0207697_10006218
275 Ga0207697_10007813
276 Ga0207697_10018670
277 Ga0207680_10033701
278 Ga0207647_10017443
279 Ga0207645_10000820
280 Ga0207684_10000411
281 Ga0207684_10003502
282 Ga0207684_10014689
283 Ga0207684_10023723
284 Ga0207684_10046646
285 Ga0207684_10092486
286 Ga0207695_10000208
287 Ga0207693_10030396
288 Ga0207693_10044597
289 Ga0207693_10057676
290 Ga0207693_10194921
291 Ga0207663_10040491
292 Ga0207657_10128059
293 Ga0207646_10000364
294 Ga0207646_10012278
295 Ga0207646_10052333
296 Ga0207681_10068291
297 Ga0207650_10058327
298 Ga0207700_10022409
299 Ga0207706_10021171
300 Ga0207670_10049981
301 Ga0207665_10228489
302 Ga0207711_10024794
303 Ga0207689_10158658
304 Ga0207689_10242467
305 Ga0207667_10013563
306 Ga0207667_10035875
307 Ga0207703_10094655
308 Ga0207678_10023985
309 Ga0207641_10130514
310 Ga0207683_10138727
311 Ga0207698_10105151
312 Ga0207428_10063457
313 Ga0268264_10013184
314 Ga0265326_10013421
315 Ga0265338_10060895
316 Ga0265320_10002782
317 Ga0265325_10079089
318 Ga0373935_0014437
319 Ga0373935_0036280
320 Ga0395900_0002411
321 Ga0395898_0002152
322 Ga0395905_0022441
323 Ga0395901_0023650
324 Ga0436365_0403615
325 Ga0436360_0311136
326 Ga0436361_0600172
327 Ga0436361_0762764
328 Ga0436361_0982820
329 Ga0436363_0433830
330 Ga0436363_0632505
331 Ga0453684_0046375
332 Ga0453684_0576598
333 Ga0495592_0000054
334 Ga0495608_0081231
335 Ga0495618_0030765
336 Ga0495628_0000241
337 Ga0495628_0031297
338 Ga0495630_0004601
339 Ga0495630_0080809
340 Ga0495643_0000057
341 Ga0495666_0019581
342 Ga0495640_0009994
343 Ga0495640_0091282
344 Ga0495640_0164101
345 Ga0495586_0002972
346 Ga0495586_0057477
347 Ga0495645_0013301
348 Ga0495634_0060496
349 Ga0495634_0147088
350 Ga0495599_0002097
351 Ga0495599_0011824
352 Ga0495658_0109699
353 Ga0495624_0037331
354 Ga0495624_0141445
355 Ga0495581_0045509
356 Ga0495674_0022696
357 Ga0495674_0088634
358 Ga0495675_0162422
359 Ga0495684_0003382
360 Ga0496101_0065050
361 Ga0496106_0050470
362 Ga0496111_0170207
363 Ga0496114_0053991
364 Ga0496115_0025956
365 Ga0501034_0245707
366 nmdc:mga03n38_3726_c1
367 nmdc:mga0k408_22017_c1
368 nmdc:mga05p37_91173_c1
369 nmdc:mga08y16_41343_c1
370 nmdc:mga08x19_186305_c1
371 Ga0495612_0067134
372 Ga0500555_004056
373 Ga0500556_0000302
374 2916974519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22468

ACT_9

ACT domain

386

444

0.99

PF00696

AA_kinase

Amino acid kinase family

46

274

0.95

PF13840

ACT_7

ACT domain

378

442

0.94

PF22468

ACT_9

ACT domain

308

366

0.93

PF01842

ACT

ACT domain

308

368

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yei-assembly2.cif.gz_F mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase 0.9637 251 399
3ab4-assembly4.cif.gz_N crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.9606 250 401
3s1t-assembly1.cif.gz_B structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis 0.9583 249 401
5yei-assembly2.cif.gz_F mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase 0.9452 251 399
3ab2-assembly2.cif.gz_F crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.9428 249 400
ID Description Score Start End Superfamily
5yeiF02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9764 261 336 3.30.70.260
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9681 251 404 3.30.2130.10
3ab4J01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9642 339 397 3.30.70.260
2zhoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9596 339 400 3.30.70.260
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9559 251 404 3.30.2130.10
ID Description Score Start End GO Terms
AF-A0A3C1KC44-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9854 60 173 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A2A5M7S7-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9848 62 161 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A3D0XKS9-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9797 79 186 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A7V2G3J5-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9751 1 178 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A3M1IEI3-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9751 1 167 GO:0004072
GO:0005829
GO:0009089
GO:0009090

Map