F287434

General Info

Members Datasets Scaffolds Average Seq Length
187 119 374 217

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10207861|Ga0070717_102078612
Length 214
Sequence MTTLQTDRTTVRRLAKRGNYDAATIRAIIDEALICHVGFVVDGAPVVIPTIHTRVGDTLYFHGSAASRMLRTLRDGVEACVTITLLDGLVLARSAFHHSMNYRSAVVFGTAREVAGEEKLRALDALVEHVCRGRSSDVRAPNEIELRQTLVLGLPIGEASAKIRTGPPIDDEEDYALDVWAGVIPMTLTPQAPIADERVKSGIEVPDYVTAYRR

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 20.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10207861 3300006028 Bacteria 1717
2 JGI25406J46586_10051653 3300003203 Bacteria 1374
3 Ga0065704_10094591 3300005289 Unclassified 2535
4 Ga0065704_10125201 3300005289 Bacteria 1704
5 Ga0065715_10093684 3300005293 Bacteria 4599
6 Ga0065707_10001878 3300005295 Bacteria 6902
7 Ga0070670_100006357 3300005331 Bacteria 9998
8 Ga0068869_100039757 3300005334 Bacteria 3360
9 Ga0068869_100192433 3300005334 Bacteria 1605
10 Ga0070680_100100516 3300005336 Bacteria 2400
11 Ga0070668_100253341 3300005347 Bacteria 1462
12 Ga0070668_100666729 3300005347 Bacteria 915
13 Ga0070669_100475525 3300005353 Bacteria 1033
14 Ga0070675_100047066 3300005354 Bacteria 3533
15 Ga0070671_100404984 3300005355 Bacteria 1167
16 Ga0070674_100088923 3300005356 Unclassified 2224
17 Ga0070673_100602199 3300005364 Bacteria 1002
18 Ga0070703_10000246 3300005406 Bacteria 26408
19 Ga0070700_100002520 3300005441 Bacteria 9339
20 Ga0070663_100334890 3300005455 Bacteria 1221
21 Ga0070663_100609927 3300005455 Bacteria 919
22 Ga0070662_100047243 3300005457 Bacteria 3096
23 Ga0070681_10061648 3300005458 Bacteria 3724
24 Ga0070681_10087572 3300005458 Unclassified 3067
25 Ga0068867_100282226 3300005459 Bacteria 1362
26 Ga0070706_100083942 3300005467 Bacteria 2951
27 Ga0070698_100001360 3300005471 Bacteria 27196
28 Ga0070699_100530944 3300005518 Bacteria 1070
29 Ga0070679_100064417 3300005530 Bacteria 3653
30 Ga0070679_100145527 3300005530 Unclassified 2348
31 Ga0070684_100145166 3300005535 Bacteria 2148
32 Ga0070684_100207688 3300005535 Unclassified 1785
33 Ga0068853_100006856 3300005539 Bacteria 9084
34 Ga0070672_100071379 3300005543 Bacteria 2762
35 Ga0068855_100355800 3300005563 Bacteria 1612
36 Ga0068855_100429477 3300005563 Unclassified 1444
37 Ga0070664_100057522 3300005564 Bacteria 3305
38 Ga0070664_100108434 3300005564 Bacteria 2421
39 Ga0070664_100557731 3300005564 Unclassified 1060
40 Ga0068857_100173859 3300005577 Bacteria 1958
41 Ga0068857_100371029 3300005577 Bacteria 1328
42 Ga0070702_100405784 3300005615 Bacteria 976
43 Ga0068852_100141862 3300005616 Bacteria 2224
44 Ga0068859_100009580 3300005617 Bacteria 9781
45 Ga0068864_100016715 3300005618 Bacteria 6113
46 Ga0068864_100064341 3300005618 Bacteria 3180
47 Ga0068864_100490203 3300005618 Bacteria 1181
48 Ga0068864_100665376 3300005618 Bacteria 1015
49 Ga0068861_100166440 3300005719 Unclassified 1823
50 Ga0068851_10127079 3300005834 Bacteria 1375
51 Ga0068870_10296812 3300005840 Bacteria 1019
52 Ga0068863_100209826 3300005841 Bacteria 1876
53 Ga0068858_100160410 3300005842 Bacteria 2117
54 Ga0068858_100379287 3300005842 Bacteria 1357
55 Ga0068858_100408909 3300005842 Bacteria 1304
56 Ga0068860_100046798 3300005843 Unclassified 4124
57 Ga0068860_100066776 3300005843 Bacteria 3417
58 Ga0068860_100148480 3300005843 Bacteria 2257
59 Ga0068862_100091352 3300005844 Bacteria 2651
60 Ga0081539_10002505 3300005985 Bacteria 25722
61 Ga0070716_100068598 3300006173 Unclassified 2075
62 Ga0097620_100009580 3300006931 Bacteria 9781
63 Ga0097620_100084227 3300006931 Bacteria 3224
64 Ga0105240_10045384 3300009093 Bacteria 5575
65 Ga0111539_10073403 3300009094 Bacteria 4034
66 Ga0111539_10827823 3300009094 Bacteria 1077
67 Ga0105247_10007781 3300009101 Bacteria 6556
68 Ga0114129_11024210 3300009147 Bacteria 1038
69 Ga0105242_10525727 3300009176 Bacteria 1130
70 Ga0105248_10279846 3300009177 Bacteria 1878
71 Ga0105248_10589826 3300009177 Bacteria 1254
72 Ga0105237_10009128 3300009545 Bacteria 10654
73 Ga0105238_10195243 3300009551 Bacteria 2000
74 Ga0105249_10038467 3300009553 Bacteria 4341
75 Ga0105249_10065904 3300009553 Bacteria 3333
76 Ga0105249_11181509 3300009553 Unclassified 836
77 Ga0105239_10009810 3300010375 Bacteria 10759
78 Ga0157373_10127470 3300013100 Bacteria 1790
79 Ga0157370_10158321 3300013104 Bacteria 2107
80 Ga0157369_10118114 3300013105 Bacteria 2815
81 Ga0157369_10186673 3300013105 Bacteria 2180
82 Ga0163162_10047718 3300013306 Bacteria 4291
83 Ga0163162_10328123 3300013306 Bacteria 1663
84 Ga0163162_10475622 3300013306 Unclassified 1381
85 Ga0163162_10834848 3300013306 Bacteria 1037
86 Ga0157372_10149149 3300013307 Bacteria 2698
87 Ga0157372_10353081 3300013307 Bacteria 1713
88 Ga0157372_10610492 3300013307 Bacteria 1271
89 Ga0157372_10921871 3300013307 Bacteria 1013
90 Ga0163163_10022841 3300014325 Bacteria 5929
91 Ga0163163_10194599 3300014325 Unclassified 2076
92 Ga0163163_10399286 3300014325 Bacteria 1433
93 Ga0157380_10012784 3300014326 Bacteria 6098
94 Ga0157380_10125118 3300014326 Bacteria 2184
95 Ga0157380_10398969 3300014326 Unclassified 1304
96 Ga0157377_10000413 3300014745 Bacteria 18560
97 Ga0157377_10048726 3300014745 Unclassified 2379
98 Ga0163161_10117291 3300017792 Unclassified 1996
99 Ga0163161_10764566 3300017792 Unclassified 809
100 Ga0207653_10000032 3300025885 Bacteria 105670
101 Ga0207710_10003926 3300025900 Bacteria 6563
102 Ga0207643_10137838 3300025908 Bacteria 1456
103 Ga0207654_10185172 3300025911 Unclassified 1361
104 Ga0207671_10042682 3300025914 Bacteria 3356
105 Ga0207660_10031202 3300025917 Bacteria 3667
106 Ga0207660_10507026 3300025917 Unclassified 979
107 Ga0207662_10029640 3300025918 Bacteria 3172
108 Ga0207649_10073880 3300025920 Bacteria 2186
109 Ga0207649_10590308 3300025920 Bacteria 853
110 Ga0207652_10303657 3300025921 Unclassified 1441
111 Ga0207681_10441580 3300025923 Bacteria 1057
112 Ga0207650_10781998 3300025925 Unclassified 808
113 Ga0207659_10350919 3300025926 Bacteria 1224
114 Ga0207644_10062448 3300025931 Bacteria 2702
115 Ga0207644_10443799 3300025931 Bacteria 1065
116 Ga0207690_10401371 3300025932 Unclassified 1093
117 Ga0207706_10006983 3300025933 Bacteria 10437
118 Ga0207704_10476336 3300025938 Bacteria 1001
119 Ga0207665_10062180 3300025939 Unclassified 2532
120 Ga0207691_10061443 3300025940 Bacteria 3413
121 Ga0207691_10078681 3300025940 Bacteria 2968
122 Ga0207711_10185234 3300025941 Bacteria 1895
123 Ga0207689_10019803 3300025942 Bacteria 5667
124 Ga0207679_10023550 3300025945 Unclassified 4212
125 Ga0207667_10249672 3300025949 Bacteria 1815
126 Ga0207651_10428706 3300025960 Bacteria 1130
127 Ga0207712_10065615 3300025961 Bacteria 2592
128 Ga0207712_10249859 3300025961 Bacteria 1433
129 Ga0207640_10069431 3300025981 Bacteria 2366
130 Ga0207677_10256262 3300026023 Bacteria 1424
131 Ga0207703_10551139 3300026035 Bacteria 1087
132 Ga0207639_10024905 3300026041 Bacteria 4336
133 Ga0207708_10005341 3300026075 Bacteria 9467
134 Ga0207708_10330704 3300026075 Bacteria 1246
135 Ga0207641_10117607 3300026088 Bacteria 2367
136 Ga0207641_10273192 3300026088 Unclassified 1587
137 Ga0207648_10041759 3300026089 Unclassified 4028
138 Ga0207674_10079548 3300026116 Unclassified 3282
139 Ga0207674_10194656 3300026116 Bacteria 1977
140 Ga0207675_100257899 3300026118 Unclassified 1689
141 Ga0207675_100340668 3300026118 Bacteria 1468
142 Ga0268265_10077533 3300028380 Bacteria 2610
143 Ga0268265_10184247 3300028380 Unclassified 1797
144 Ga0268264_10004087 3300028381 Bacteria 12490
145 Ga0307408_100134395 3300031548 Bacteria 1933
146 Ga0307405_10009448 3300031731 Bacteria 5001
147 Ga0307405_10041270 3300031731 Unclassified 2800
148 Ga0307405_10242793 3300031731 Bacteria 1335
149 Ga0307413_10001894 3300031824 Bacteria 8278
150 Ga0307413_10013856 3300031824 Unclassified 4073
151 Ga0307413_10092872 3300031824 Archaea 1971
152 Ga0307410_10000135 3300031852 Bacteria 26235
153 Ga0307410_10006603 3300031852 Bacteria 6274
154 Ga0307410_10010618 3300031852 Bacteria 5227
155 Ga0307406_10022298 3300031901 Bacteria 3755
156 Ga0307406_10066626 3300031901 Bacteria 2345
157 Ga0307406_10219985 3300031901 Bacteria 1411
158 Ga0307407_10012936 3300031903 Unclassified 4031
159 Ga0307407_10072357 3300031903 Bacteria 2056
160 Ga0307407_10352602 3300031903 Bacteria 1042
161 Ga0307412_10005077 3300031911 Bacteria 7361
162 Ga0307412_10399495 3300031911 Unclassified 1118
163 Ga0307409_100006193 3300031995 Bacteria 7000
164 Ga0307409_100095100 3300031995 Unclassified 2454
165 Ga0307409_100352815 3300031995 Bacteria 1389
166 Ga0307409_100537983 3300031995 Unclassified 1144
167 Ga0307416_100238249 3300032002 Bacteria 1760
168 Ga0307416_100260758 3300032002 Unclassified 1694
169 Ga0307416_100345122 3300032002 Bacteria 1504
170 Ga0307416_100686225 3300032002 Bacteria 1112
171 Ga0307414_10040790 3300032004 Bacteria 3138
172 Ga0307414_10111147 3300032004 Unclassified 2086
173 Ga0307411_10005591 3300032005 Bacteria 6194
174 Ga0307411_10349357 3300032005 Bacteria 1205
175 Ga0307415_100004860 3300032126 Bacteria 7050
176 Ga0307415_100016667 3300032126 Unclassified 4386
177 Ga0307415_100050786 3300032126 Bacteria 2812
178 Ga0395900_0467733 3300037418 Bacteria 1215
179 Ga0395900_1057710 3300037418 Bacteria 730
180 Ga0395905_0184197 3300037471 Bacteria 1960
181 Ga0436364_0772055 3300037853 Bacteria 1395
182 Ga0395901_0196567 3300038443 Bacteria 2115
183 Ga0439438_078954 3300041405 Bacteria 809
184 Ga0495580_0201639 3300046472 Bacteria 1370
185 Ga0496124_0032152 3300048927 Bacteria 4639
186 nmdc:mga0a205_217666_c1 3300050515 Bacteria 1796
187 Ga0501082_0361338 3300060353 Bacteria 1266
188 Ga0070717_10207861
189 JGI25406J46586_10051653
190 Ga0065704_10094591
191 Ga0065704_10125201
192 Ga0065715_10093684
193 Ga0065707_10001878
194 Ga0070670_100006357
195 Ga0068869_100039757
196 Ga0068869_100192433
197 Ga0070680_100100516
198 Ga0070668_100253341
199 Ga0070668_100666729
200 Ga0070669_100475525
201 Ga0070675_100047066
202 Ga0070671_100404984
203 Ga0070674_100088923
204 Ga0070673_100602199
205 Ga0070703_10000246
206 Ga0070700_100002520
207 Ga0070663_100334890
208 Ga0070663_100609927
209 Ga0070662_100047243
210 Ga0070681_10061648
211 Ga0070681_10087572
212 Ga0068867_100282226
213 Ga0070706_100083942
214 Ga0070698_100001360
215 Ga0070699_100530944
216 Ga0070679_100064417
217 Ga0070679_100145527
218 Ga0070684_100145166
219 Ga0070684_100207688
220 Ga0068853_100006856
221 Ga0070672_100071379
222 Ga0068855_100355800
223 Ga0068855_100429477
224 Ga0070664_100057522
225 Ga0070664_100108434
226 Ga0070664_100557731
227 Ga0068857_100173859
228 Ga0068857_100371029
229 Ga0070702_100405784
230 Ga0068852_100141862
231 Ga0068859_100009580
232 Ga0068864_100016715
233 Ga0068864_100064341
234 Ga0068864_100490203
235 Ga0068864_100665376
236 Ga0068861_100166440
237 Ga0068851_10127079
238 Ga0068870_10296812
239 Ga0068863_100209826
240 Ga0068858_100160410
241 Ga0068858_100379287
242 Ga0068858_100408909
243 Ga0068860_100046798
244 Ga0068860_100066776
245 Ga0068860_100148480
246 Ga0068862_100091352
247 Ga0081539_10002505
248 Ga0070716_100068598
249 Ga0097620_100009580
250 Ga0097620_100084227
251 Ga0105240_10045384
252 Ga0111539_10073403
253 Ga0111539_10827823
254 Ga0105247_10007781
255 Ga0114129_11024210
256 Ga0105242_10525727
257 Ga0105248_10279846
258 Ga0105248_10589826
259 Ga0105237_10009128
260 Ga0105238_10195243
261 Ga0105249_10038467
262 Ga0105249_10065904
263 Ga0105249_11181509
264 Ga0105239_10009810
265 Ga0157373_10127470
266 Ga0157370_10158321
267 Ga0157369_10118114
268 Ga0157369_10186673
269 Ga0163162_10047718
270 Ga0163162_10328123
271 Ga0163162_10475622
272 Ga0163162_10834848
273 Ga0157372_10149149
274 Ga0157372_10353081
275 Ga0157372_10610492
276 Ga0157372_10921871
277 Ga0163163_10022841
278 Ga0163163_10194599
279 Ga0163163_10399286
280 Ga0157380_10012784
281 Ga0157380_10125118
282 Ga0157380_10398969
283 Ga0157377_10000413
284 Ga0157377_10048726
285 Ga0163161_10117291
286 Ga0163161_10764566
287 Ga0207653_10000032
288 Ga0207710_10003926
289 Ga0207643_10137838
290 Ga0207654_10185172
291 Ga0207671_10042682
292 Ga0207660_10031202
293 Ga0207660_10507026
294 Ga0207662_10029640
295 Ga0207649_10073880
296 Ga0207649_10590308
297 Ga0207652_10303657
298 Ga0207681_10441580
299 Ga0207650_10781998
300 Ga0207659_10350919
301 Ga0207644_10062448
302 Ga0207644_10443799
303 Ga0207690_10401371
304 Ga0207706_10006983
305 Ga0207704_10476336
306 Ga0207665_10062180
307 Ga0207691_10061443
308 Ga0207691_10078681
309 Ga0207711_10185234
310 Ga0207689_10019803
311 Ga0207679_10023550
312 Ga0207667_10249672
313 Ga0207651_10428706
314 Ga0207712_10065615
315 Ga0207712_10249859
316 Ga0207640_10069431
317 Ga0207677_10256262
318 Ga0207703_10551139
319 Ga0207639_10024905
320 Ga0207708_10005341
321 Ga0207708_10330704
322 Ga0207641_10117607
323 Ga0207641_10273192
324 Ga0207648_10041759
325 Ga0207674_10079548
326 Ga0207674_10194656
327 Ga0207675_100257899
328 Ga0207675_100340668
329 Ga0268265_10077533
330 Ga0268265_10184247
331 Ga0268264_10004087
332 Ga0307408_100134395
333 Ga0307405_10009448
334 Ga0307405_10041270
335 Ga0307405_10242793
336 Ga0307413_10001894
337 Ga0307413_10013856
338 Ga0307413_10092872
339 Ga0307410_10000135
340 Ga0307410_10006603
341 Ga0307410_10010618
342 Ga0307406_10022298
343 Ga0307406_10066626
344 Ga0307406_10219985
345 Ga0307407_10012936
346 Ga0307407_10072357
347 Ga0307407_10352602
348 Ga0307412_10005077
349 Ga0307412_10399495
350 Ga0307409_100006193
351 Ga0307409_100095100
352 Ga0307409_100352815
353 Ga0307409_100537983
354 Ga0307416_100238249
355 Ga0307416_100260758
356 Ga0307416_100345122
357 Ga0307416_100686225
358 Ga0307414_10040790
359 Ga0307414_10111147
360 Ga0307411_10005591
361 Ga0307411_10349357
362 Ga0307415_100004860
363 Ga0307415_100016667
364 Ga0307415_100050786
365 Ga0395900_0467733
366 Ga0395900_1057710
367 Ga0395905_0184197
368 Ga0436364_0772055
369 Ga0395901_0196567
370 Ga0439438_078954
371 Ga0495580_0201639
372 Ga0496124_0032152
373 nmdc:mga0a205_217666_c1
374 Ga0501082_0361338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

21

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.9203 15 208
2fur-assembly1.cif.gz_B crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution 0.9197 18 193
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8804 4 208
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.8695 15 208
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8572 4 208
ID Description Score Start End Superfamily
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.92 15 208 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.906 21 193 2.30.110.10
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8693 15 208 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.852 19 164 2.30.110.10
2w5eA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8509 31 60 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A537YY06-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9567 81 208
AF-A0A7V1U7T9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.952 61 208
AF-A0A2E6EBE0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9502 32 208
AF-T0Z503-F1-model_v4 Flavin-nucleotide-binding protein-like protein 0.949 76 206
AF-A0A6J6XW51-F1-model_v4 Unannotated protein 0.9484 28 208

Map