F287384

General Info

Members Datasets Scaffolds Average Seq Length
187 142 374 135

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100688009|Ga0068861_1006880092
Length 156
Sequence MILCPIQLNNQENNLIFKSDFMKNKIGTKEKPMVLKTPPLSSEYTMHTDIKDGREVLVCTVGKTVLLYDYRCLTDLHAMLKKHGDWMELGSADEQKPAKEGTVEAWGCSKKNPVGGWYGLKKGLRERFGMYIPPLMEALGLVELTHDAKGNKMKAK

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
141 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 0.53
Rhizosphere 87.17
Stem 0
Stem Tuber 0
Unclassified 16.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100688009 3300005719 Bacteria 949
2 rootH1_10043582 3300003316 Bacteria 19382
3 rootL2_10284014 3300003322 Unclassified 3037
4 rootH1_10375131 3300003323 Bacteria 1338
5 Ga0055536_1002831 3300003781 Bacteria 9558
6 Ga0055534_1057532 3300003784 Bacteria 545
7 Ga0055543_1041059 3300004625 Bacteria 780
8 Ga0065165_1000226 3300005262 Bacteria 99005
9 Ga0065714_10012907 3300005288 Bacteria 2532
10 Ga0065707_10127875 3300005295 Bacteria 1973
11 Ga0070670_100145497 3300005331 Bacteria 2050
12 Ga0070666_10891323 3300005335 Unclassified 657
13 Ga0070680_100393511 3300005336 Bacteria 1181
14 Ga0070689_101129829 3300005340 Bacteria 701
15 Ga0070675_100135023 3300005354 Bacteria 2105
16 Ga0070671_100933074 3300005355 Bacteria 759
17 Ga0070674_100948911 3300005356 Bacteria 752
18 Ga0070673_100780274 3300005364 Bacteria 881
19 Ga0070659_100542680 3300005366 Bacteria 995
20 Ga0070714_101718990 3300005435 Bacteria 613
21 Ga0070681_10054015 3300005458 Bacteria 4003
22 Ga0070685_10328817 3300005466 Bacteria 1038
23 Ga0070699_101861304 3300005518 Bacteria 551
24 Ga0070684_100121844 3300005535 Bacteria 2346
25 Ga0068853_101535040 3300005539 Bacteria 645
26 Ga0070665_100261707 3300005548 Bacteria 1731
27 Ga0070665_102158175 3300005548 Unclassified 561
28 Ga0070704_100413548 3300005549 Bacteria 1153
29 Ga0068855_100202789 3300005563 Unclassified 2232
30 Ga0068855_100350387 3300005563 Bacteria 1626
31 Ga0070664_100256408 3300005564 Bacteria 1573
32 Ga0068854_100196056 3300005578 Unclassified 1585
33 Ga0068854_101391339 3300005578 Unclassified 634
34 Ga0068856_100340341 3300005614 Bacteria 1518
35 Ga0070702_101635126 3300005615 Unclassified 534
36 Ga0068859_100052051 3300005617 Bacteria 4118
37 Ga0068859_100627460 3300005617 Bacteria 1167
38 Ga0068866_10710421 3300005718 Bacteria 690
39 Ga0068851_10000105 3300005834 Bacteria 45381
40 Ga0068851_10715432 3300005834 Bacteria 617
41 Ga0068870_11011862 3300005840 Unclassified 593
42 Ga0068860_100005317 3300005843 Bacteria 13067
43 Ga0068860_100055029 3300005843 Bacteria 3782
44 Ga0068862_100022015 3300005844 Bacteria 5331
45 Ga0070716_100076440 3300006173 Unclassified 1984
46 Ga0070712_100898913 3300006175 Bacteria 763
47 Ga0075427_10039272 3300006194 Bacteria 794
48 Ga0068871_101044041 3300006358 Bacteria 762
49 Ga0075430_101565156 3300006846 Bacteria 541
50 Ga0075431_100192212 3300006847 Bacteria 2091
51 Ga0075431_100337954 3300006847 Bacteria 1516
52 Ga0075434_100792688 3300006871 Bacteria 964
53 Ga0075429_100001609 3300006880 Bacteria 18633
54 Ga0075429_100080327 3300006880 Bacteria 2843
55 Ga0075429_100192874 3300006880 Bacteria 1785
56 Ga0075429_101838597 3300006880 Unclassified 525
57 Ga0097620_100052050 3300006931 Bacteria 4118
58 Ga0097620_100225843 3300006931 Bacteria 1960
59 Ga0097620_100627534 3300006931 Bacteria 1167
60 Ga0105240_10041774 3300009093 Bacteria 5848
61 Ga0105240_10577144 3300009093 Bacteria 1241
62 Ga0105245_10275780 3300009098 Bacteria 1642
63 Ga0114129_10029517 3300009147 Bacteria 7767
64 Ga0114129_10059173 3300009147 Bacteria 5357
65 Ga0114129_11082277 3300009147 Unclassified 1005
66 Ga0105243_12001733 3300009148 Unclassified 614
67 Ga0105242_10260408 3300009176 Bacteria 1566
68 Ga0105242_11116322 3300009176 Bacteria 803
69 Ga0105248_10280344 3300009177 Bacteria 1876
70 Ga0105248_10472963 3300009177 Bacteria 1413
71 Ga0105237_10003384 3300009545 Bacteria 18969
72 Ga0105237_11077801 3300009545 Bacteria 810
73 Ga0105238_10080824 3300009551 Bacteria 3240
74 Ga0105249_10665619 3300009553 Unclassified 1099
75 Ga0105249_10910693 3300009553 Bacteria 946
76 Ga0105239_10000069 3300010375 Bacteria 144493
77 Ga0157378_10286622 3300013297 Bacteria 1589
78 Ga0157378_10317406 3300013297 Bacteria 1513
79 Ga0157378_11250404 3300013297 Bacteria 783
80 Ga0163162_10345750 3300013306 Unclassified 1620
81 Ga0163162_10557260 3300013306 Bacteria 1274
82 Ga0157372_10217278 3300013307 Bacteria 2216
83 Ga0157372_11448018 3300013307 Bacteria 792
84 Ga0157372_13069846 3300013307 Bacteria 533
85 Ga0157375_10241436 3300013308 Bacteria 1966
86 Ga0157375_10638852 3300013308 Bacteria 1221
87 Ga0157375_11339137 3300013308 Bacteria 842
88 Ga0163163_10018254 3300014325 Bacteria 6562
89 Ga0163163_10167632 3300014325 Bacteria 2243
90 Ga0163163_11164712 3300014325 Bacteria 834
91 Ga0157379_10235256 3300014968 Bacteria 1661
92 Ga0157379_10656783 3300014968 Bacteria 982
93 Ga0157379_11455335 3300014968 Bacteria 665
94 Ga0157376_10816506 3300014969 Bacteria 946
95 Ga0157376_12744989 3300014969 Bacteria 532
96 Ga0209675_1014065 3300025291 Bacteria 2459
97 Ga0209676_1001032 3300025292 Bacteria 32333
98 Ga0209025_1001622 3300025294 Bacteria 28102
99 Ga0209050_1034927 3300025298 Bacteria 1495
100 Ga0207426_1026404 3300025302 Unclassified 1945
101 Ga0207656_10000170 3300025321 Bacteria 23964
102 Ga0207695_10431785 3300025913 Bacteria 1201
103 Ga0207671_10004372 3300025914 Bacteria 13548
104 Ga0207693_10911610 3300025915 Bacteria 674
105 Ga0207652_10776733 3300025921 Bacteria 851
106 Ga0207681_10573177 3300025923 Unclassified 931
107 Ga0207694_10142503 3300025924 Bacteria 1928
108 Ga0207659_10108604 3300025926 Bacteria 2105
109 Ga0207664_10405749 3300025929 Bacteria 1212
110 Ga0207690_10436858 3300025932 Bacteria 1050
111 Ga0207686_10117666 3300025934 Bacteria 1803
112 Ga0207669_10988378 3300025937 Bacteria 707
113 Ga0207665_10224247 3300025939 Unclassified 1379
114 Ga0207665_10510909 3300025939 Bacteria 929
115 Ga0207711_10052679 3300025941 Bacteria 3488
116 Ga0207711_10349494 3300025941 Bacteria 1369
117 Ga0207689_10005528 3300025942 Bacteria 11289
118 Ga0207661_10224770 3300025944 Bacteria 1660
119 Ga0207667_10454082 3300025949 Unclassified 1302
120 Ga0207651_11054275 3300025960 Unclassified 728
121 Ga0207712_10570594 3300025961 Unclassified 975
122 Ga0207640_10178375 3300025981 Unclassified 1590
123 Ga0207658_11206398 3300025986 Unclassified 692
124 Ga0207702_10397835 3300026078 Bacteria 1328
125 Ga0207674_11868751 3300026116 Bacteria 567
126 Ga0207675_100023797 3300026118 Bacteria 5699
127 Ga0207675_101048253 3300026118 Bacteria 835
128 Ga0207675_101754257 3300026118 Bacteria 640
129 Ga0268265_10018492 3300028380 Bacteria 4831
130 Ga0268264_10006110 3300028381 Bacteria 10174
131 Ga0268264_10144488 3300028381 Bacteria 2125
132 Ga0265319_1155291 3300028563 Bacteria 708
133 Ga0265334_10014276 3300028573 Bacteria 3312
134 Ga0265318_10009668 3300028577 Bacteria 4230
135 Ga0265318_10072470 3300028577 Bacteria 1276
136 Ga0307515_10223489 3300028794 Unclassified 1694
137 Ga0265338_10028197 3300028800 Bacteria 5606
138 Ga0265338_11134069 3300028800 Bacteria 526
139 Ga0265324_10209721 3300029957 Bacteria 661
140 Ga0265324_10220264 3300029957 Bacteria 644
141 Ga0265330_10090589 3300031235 Unclassified 1313
142 Ga0265332_10094113 3300031238 Bacteria 1266
143 Ga0265320_10232608 3300031240 Bacteria 819
144 Ga0265320_10310530 3300031240 Unclassified 697
145 Ga0265325_10236193 3300031241 Bacteria 832
146 Ga0265339_10018928 3300031249 Bacteria 4050
147 Ga0265316_10019288 3300031344 Bacteria 5837
148 Ga0265313_10080708 3300031595 Bacteria 1478
149 Ga0307508_10722946 3300031616 Bacteria 607
150 Ga0265314_10287896 3300031711 Unclassified 926
151 Ga0265342_10026107 3300031712 Bacteria 3664
152 Ga0307516_10004755 3300031730 Bacteria 16578
153 Ga0307416_100055774 3300032002 Bacteria 3185
154 Ga0451800_0870638 3300041459 Bacteria 513
155 Ga0451577_0468759 3300042876 Bacteria 1143
156 Ga0453684_0145912 3300044712 Unclassified 2819
157 Ga0453684_0881266 3300044712 Unclassified 960
158 Ga0451576_1608328 3300045051 Bacteria 674
159 Ga0495638_0247624 3300046460 Bacteria 984
160 Ga0495606_0110807 3300046507 Bacteria 1656
161 Ga0495648_0103081 3300046524 Bacteria 1570
162 Ga0495668_0000227 3300046616 Bacteria 81234
163 Ga0495588_0324732 3300046674 Bacteria 809
164 Ga0495671_0335190 3300046692 Unclassified 726
165 Ga0495672_0035741 3300047320 Bacteria 3058
166 Ga0495686_0414268 3300047472 Unclassified 721
167 Ga0501040_0098473 3300049576 Bacteria 2038
168 Ga0501072_0346943 3300049588 Bacteria 1179
169 Ga0501075_0920372 3300049591 Bacteria 665
170 Ga0501075_1032249 3300049591 Bacteria 625
171 Ga0501076_0800560 3300049592 Bacteria 778
172 Ga0501045_0443080 3300049824 Bacteria 966
173 nmdc:mga0yw44_431971_c1 3300050492 Bacteria 892
174 nmdc:mga05p37_248057_c1 3300050507 Bacteria 2137
175 nmdc:mga05p37_3011_c1 3300050507 Bacteria 19550
176 nmdc:mga09592_6529_c1 3300050508 Bacteria 9500
177 nmdc:mga06r32_129125_c1 3300050510 Bacteria 2497
178 nmdc:mga06r32_393648_c1 3300050510 Bacteria 1368
179 nmdc:mga0n895_1804231_c1 3300050512 Bacteria 572
180 Ga0500635_0010824 3300053080 Bacteria 2575
181 Ga0500642_0122765 3300053130 Bacteria 1215
182 Ga0500588_0078549 3300053146 Bacteria 1099
183 Ga0500616_0194147 3300053153 Bacteria 904
184 Ga0500616_0359909 3300053153 Bacteria 590
185 Ga0500627_0010624 3300053158 Bacteria 3364
186 Ga0500611_000013 3300053727 Bacteria 135447
187 Ga0501084_0672151 3300054114 Bacteria 874
188 Ga0068861_100688009
189 rootH1_10043582
190 rootL2_10284014
191 rootH1_10375131
192 Ga0055536_1002831
193 Ga0055534_1057532
194 Ga0055543_1041059
195 Ga0065165_1000226
196 Ga0065714_10012907
197 Ga0065707_10127875
198 Ga0070670_100145497
199 Ga0070666_10891323
200 Ga0070680_100393511
201 Ga0070689_101129829
202 Ga0070675_100135023
203 Ga0070671_100933074
204 Ga0070674_100948911
205 Ga0070673_100780274
206 Ga0070659_100542680
207 Ga0070714_101718990
208 Ga0070681_10054015
209 Ga0070685_10328817
210 Ga0070699_101861304
211 Ga0070684_100121844
212 Ga0068853_101535040
213 Ga0070665_100261707
214 Ga0070665_102158175
215 Ga0070704_100413548
216 Ga0068855_100202789
217 Ga0068855_100350387
218 Ga0070664_100256408
219 Ga0068854_100196056
220 Ga0068854_101391339
221 Ga0068856_100340341
222 Ga0070702_101635126
223 Ga0068859_100052051
224 Ga0068859_100627460
225 Ga0068866_10710421
226 Ga0068851_10000105
227 Ga0068851_10715432
228 Ga0068870_11011862
229 Ga0068860_100005317
230 Ga0068860_100055029
231 Ga0068862_100022015
232 Ga0070716_100076440
233 Ga0070712_100898913
234 Ga0075427_10039272
235 Ga0068871_101044041
236 Ga0075430_101565156
237 Ga0075431_100192212
238 Ga0075431_100337954
239 Ga0075434_100792688
240 Ga0075429_100001609
241 Ga0075429_100080327
242 Ga0075429_100192874
243 Ga0075429_101838597
244 Ga0097620_100052050
245 Ga0097620_100225843
246 Ga0097620_100627534
247 Ga0105240_10041774
248 Ga0105240_10577144
249 Ga0105245_10275780
250 Ga0114129_10029517
251 Ga0114129_10059173
252 Ga0114129_11082277
253 Ga0105243_12001733
254 Ga0105242_10260408
255 Ga0105242_11116322
256 Ga0105248_10280344
257 Ga0105248_10472963
258 Ga0105237_10003384
259 Ga0105237_11077801
260 Ga0105238_10080824
261 Ga0105249_10665619
262 Ga0105249_10910693
263 Ga0105239_10000069
264 Ga0157378_10286622
265 Ga0157378_10317406
266 Ga0157378_11250404
267 Ga0163162_10345750
268 Ga0163162_10557260
269 Ga0157372_10217278
270 Ga0157372_11448018
271 Ga0157372_13069846
272 Ga0157375_10241436
273 Ga0157375_10638852
274 Ga0157375_11339137
275 Ga0163163_10018254
276 Ga0163163_10167632
277 Ga0163163_11164712
278 Ga0157379_10235256
279 Ga0157379_10656783
280 Ga0157379_11455335
281 Ga0157376_10816506
282 Ga0157376_12744989
283 Ga0209675_1014065
284 Ga0209676_1001032
285 Ga0209025_1001622
286 Ga0209050_1034927
287 Ga0207426_1026404
288 Ga0207656_10000170
289 Ga0207695_10431785
290 Ga0207671_10004372
291 Ga0207693_10911610
292 Ga0207652_10776733
293 Ga0207681_10573177
294 Ga0207694_10142503
295 Ga0207659_10108604
296 Ga0207664_10405749
297 Ga0207690_10436858
298 Ga0207686_10117666
299 Ga0207669_10988378
300 Ga0207665_10224247
301 Ga0207665_10510909
302 Ga0207711_10052679
303 Ga0207711_10349494
304 Ga0207689_10005528
305 Ga0207661_10224770
306 Ga0207667_10454082
307 Ga0207651_11054275
308 Ga0207712_10570594
309 Ga0207640_10178375
310 Ga0207658_11206398
311 Ga0207702_10397835
312 Ga0207674_11868751
313 Ga0207675_100023797
314 Ga0207675_101048253
315 Ga0207675_101754257
316 Ga0268265_10018492
317 Ga0268264_10006110
318 Ga0268264_10144488
319 Ga0265319_1155291
320 Ga0265334_10014276
321 Ga0265318_10009668
322 Ga0265318_10072470
323 Ga0307515_10223489
324 Ga0265338_10028197
325 Ga0265338_11134069
326 Ga0265324_10209721
327 Ga0265324_10220264
328 Ga0265330_10090589
329 Ga0265332_10094113
330 Ga0265320_10232608
331 Ga0265320_10310530
332 Ga0265325_10236193
333 Ga0265339_10018928
334 Ga0265316_10019288
335 Ga0265313_10080708
336 Ga0307508_10722946
337 Ga0265314_10287896
338 Ga0265342_10026107
339 Ga0307516_10004755
340 Ga0307416_100055774
341 Ga0451800_0870638
342 Ga0451577_0468759
343 Ga0453684_0145912
344 Ga0453684_0881266
345 Ga0451576_1608328
346 Ga0495638_0247624
347 Ga0495606_0110807
348 Ga0495648_0103081
349 Ga0495668_0000227
350 Ga0495588_0324732
351 Ga0495671_0335190
352 Ga0495672_0035741
353 Ga0495686_0414268
354 Ga0501040_0098473
355 Ga0501072_0346943
356 Ga0501075_0920372
357 Ga0501075_1032249
358 Ga0501076_0800560
359 Ga0501045_0443080
360 nmdc:mga0yw44_431971_c1
361 nmdc:mga05p37_248057_c1
362 nmdc:mga05p37_3011_c1
363 nmdc:mga09592_6529_c1
364 nmdc:mga06r32_129125_c1
365 nmdc:mga06r32_393648_c1
366 nmdc:mga0n895_1804231_c1
367 Ga0500635_0010824
368 Ga0500642_0122765
369 Ga0500588_0078549
370 Ga0500616_0194147
371 Ga0500616_0359909
372 Ga0500627_0010624
373 Ga0500611_000013
374 Ga0501084_0672151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21619

DUF6855

Family of unknown function (DUF6855)

25

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8u11-assembly1.cif.gz_6 in situ cryo-em structure of bacteriophage p22 gp1:gp5:gp4: gp10: gp9 n-term complex in conformation 2 at 3.1a resolution 0.7305 23 49
8eap-assembly1.cif.gz_G cryo-em structure of the in-situ gp10-gp26 from bacteriophage p22 0.7214 23 49
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.717 25 48
3mx7-assembly1.cif.gz_A crystal structure analysis of human faim-ntd 0.6959 10 46
3lfk-assembly1.cif.gz_A a reported archaeal mechanosensitive channel is a structural homolog of marr-like transcriptional regulators 0.6804 50 135
ID Description Score Start End Superfamily
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7862 114 135 1.10.10.10
af_Q9V4E7_58_597_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7833 23 46 1.20.1740.10
af_Q54UM1_2_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7801 50 135 1.10.10.10
af_P22137_1_370_2.130.10.110 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain 0.7752 23 48 2.130.10.110
af_Q9SUP3_137_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7691 52 135 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V5JG82-F1-model_v4 deleted 0.993 14 135
AF-A0A7X9KHG0-F1-model_v4 DUF6855 domain-containing protein 0.9891 34 135
AF-A0A1V5JG82-F1-model_v4 deleted 0.985 14 135
AF-A0A7X9KHG0-F1-model_v4 DUF6855 domain-containing protein 0.9795 34 135
AF-A0A352MHI0-F1-model_v4 DUF6855 domain-containing protein 0.9779 51 135

Map