F286706

General Info

Members Datasets Scaffolds Average Seq Length
186 99 185 200

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0107948|Ga0501070_0107948_799_1521
Length 240
Sequence VINKDIGAKERILPLNKIFLWRFSKILFEKNLTFKKTIIMSLLLNRNTFGDMANKGKTLSREEANSLLNEWVLNDKLRLHMRQVAHLMKSWAAQKEDLDEEDQWRWETAGLLHDADWDQWPEQHCKKIIEELETRNVDPEIIHAIASHGPNHFGVDPETKMDKMLYAFDELSGLIHAYSLMRPNGYEGMELKGVKKRLKEKSFAANVSREEIADACLRAGVALETLIPFIIQHQAQVSLD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12227882 2162886012 Unclassified 899
2 rootH2_10041737 3300003320 Bacteria 1143
3 rootH1_10219639 3300003323 Bacteria 1130
4 Ga0070658_10010500 3300005327 Bacteria 7422
5 Ga0070658_10067975 3300005327 Bacteria 2912
6 Ga0070658_10139912 3300005327 Bacteria 2021
7 Ga0070658_10420872 3300005327 Bacteria 1149
8 Ga0070683_100229964 3300005329 Bacteria 1763
9 Ga0070670_100256501 3300005331 Bacteria 1524
10 Ga0070670_100325165 3300005331 Bacteria 1348
11 Ga0070670_100830481 3300005331 Bacteria 835
12 Ga0070680_100030654 3300005336 Bacteria 4321
13 Ga0070680_100175490 3300005336 Unclassified 1804
14 Ga0070680_100374589 3300005336 Unclassified 1212
15 Ga0070680_100459774 3300005336 Bacteria 1087
16 Ga0070660_100000242 3300005339 Bacteria 36371
17 Ga0070661_100353679 3300005344 Bacteria 1153
18 Ga0070692_10142407 3300005345 Bacteria 1358
19 Ga0070675_100282537 3300005354 Bacteria 1459
20 Ga0070675_101050453 3300005354 Unclassified 748
21 Ga0070671_100896881 3300005355 Bacteria 774
22 Ga0070688_100570850 3300005365 Bacteria 862
23 Ga0070659_100119040 3300005366 Unclassified 2137
24 Ga0070659_100139353 3300005366 Unclassified 1974
25 Ga0070659_100645082 3300005366 Unclassified 913
26 Ga0070667_100596702 3300005367 Bacteria 1017
27 Ga0070714_100317053 3300005435 Bacteria 1457
28 Ga0070663_101037993 3300005455 Bacteria 714
29 Ga0070678_100079422 3300005456 Bacteria 2481
30 Ga0070678_100247911 3300005456 Bacteria 1492
31 Ga0070681_10078020 3300005458 Bacteria 3269
32 Ga0070681_10135111 3300005458 Bacteria 2397
33 Ga0070681_10157998 3300005458 Bacteria 2191
34 Ga0070681_10190329 3300005458 Bacteria 1971
35 Ga0068867_100332527 3300005459 Bacteria 1262
36 Ga0070679_100000103 3300005530 Bacteria 66004
37 Ga0070679_100015017 3300005530 Bacteria 7440
38 Ga0070679_100090937 3300005530 Bacteria 3040
39 Ga0070684_100500402 3300005535 Bacteria 1125
40 Ga0070684_100742256 3300005535 Unclassified 916
41 Ga0068853_100011101 3300005539 Bacteria 7307
42 Ga0068853_100169004 3300005539 Bacteria 1977
43 Ga0068853_100237020 3300005539 Bacteria 1671
44 Ga0068853_100458623 3300005539 Bacteria 1199
45 Ga0068853_100709843 3300005539 Bacteria 959
46 Ga0068855_100010851 3300005563 Bacteria 10999
47 Ga0068855_100371289 3300005563 Bacteria 1572
48 Ga0068857_101195434 3300005577 Bacteria 736
49 Ga0068854_100488135 3300005578 Bacteria 1035
50 Ga0068856_100323714 3300005614 Bacteria 1559
51 Ga0068856_100400775 3300005614 Bacteria 1392
52 Ga0068852_100329031 3300005616 Unclassified 1486
53 Ga0068852_100412385 3300005616 Bacteria 1331
54 Ga0068859_100419345 3300005617 Bacteria 1435
55 Ga0068861_100516981 3300005719 Bacteria 1082
56 Ga0068863_100421794 3300005841 Unclassified 1307
57 Ga0068863_100536975 3300005841 Bacteria 1154
58 Ga0081539_10000622 3300005985 Bacteria 71778
59 Ga0097621_100023305 3300006237 Bacteria 4818
60 Ga0068865_100181319 3300006881 Bacteria 1622
61 Ga0097620_100419361 3300006931 Bacteria 1435
62 Ga0105245_10172001 3300009098 Bacteria 2063
63 Ga0105245_10331886 3300009098 Bacteria 1501
64 Ga0105241_10058293 3300009174 Bacteria 2965
65 Ga0105242_11471203 3300009176 Bacteria 711
66 Ga0105237_10016797 3300009545 Bacteria 7598
67 Ga0105249_10456979 3300009553 Bacteria 1316
68 Ga0157373_10013181 3300013100 Bacteria 6068
69 Ga0157373_10037288 3300013100 Bacteria 3486
70 Ga0157373_10066521 3300013100 Bacteria 2549
71 Ga0157373_10532493 3300013100 Bacteria 851
72 Ga0157371_10000418 3300013102 Bacteria 52571
73 Ga0157371_10001753 3300013102 Bacteria 21998
74 Ga0157371_10003716 3300013102 Bacteria 13684
75 Ga0157371_10016749 3300013102 Bacteria 5460
76 Ga0157371_10069325 3300013102 Bacteria 2497
77 Ga0157371_10097337 3300013102 Bacteria 2086
78 Ga0157371_10129331 3300013102 Bacteria 1796
79 Ga0157371_10164309 3300013102 Bacteria 1585
80 Ga0157371_10483449 3300013102 Bacteria 913
81 Ga0157370_10001052 3300013104 Bacteria 34697
82 Ga0157370_10618671 3300013104 Bacteria 991
83 Ga0157369_10024089 3300013105 Bacteria 6774
84 Ga0157369_10050636 3300013105 Bacteria 4496
85 Ga0157369_10112072 3300013105 Bacteria 2899
86 Ga0157378_10037684 3300013297 Bacteria 4284
87 Ga0157378_10780121 3300013297 Bacteria 980
88 Ga0157378_11126061 3300013297 Bacteria 822
89 Ga0163162_11157443 3300013306 Bacteria 877
90 Ga0157372_10005977 3300013307 Bacteria 12934
91 Ga0157372_10039945 3300013307 Bacteria 5181
92 Ga0157372_10203766 3300013307 Bacteria 2292
93 Ga0157372_10292292 3300013307 Bacteria 1895
94 Ga0157375_11343093 3300013308 Bacteria 841
95 Ga0163163_10321045 3300014325 Bacteria 1602
96 Ga0163163_10326971 3300014325 Bacteria 1587
97 Ga0157380_10616070 3300014326 Bacteria 1077
98 Ga0157379_10230402 3300014968 Bacteria 1679
99 Ga0157376_10419076 3300014969 Bacteria 1299
100 Ga0163161_10093017 3300017792 Bacteria 2233
101 Ga0163161_10658493 3300017792 Bacteria 868
102 Ga0207647_10125478 3300025904 Bacteria 1511
103 Ga0207645_10320941 3300025907 Unclassified 1033
104 Ga0207705_10005765 3300025909 Bacteria 9239
105 Ga0207705_10039831 3300025909 Unclassified 3368
106 Ga0207705_10109341 3300025909 Bacteria 2041
107 Ga0207705_10126840 3300025909 Bacteria 1897
108 Ga0207705_10263169 3300025909 Bacteria 1317
109 Ga0207705_10298808 3300025909 Bacteria 1235
110 Ga0207707_10030532 3300025912 Bacteria 4715
111 Ga0207707_10145694 3300025912 Bacteria 2070
112 Ga0207660_10234259 3300025917 Unclassified 1444
113 Ga0207657_10001477 3300025919 Bacteria 25123
114 Ga0207657_10010232 3300025919 Bacteria 9369
115 Ga0207657_10049017 3300025919 Bacteria 3684
116 Ga0207657_10198257 3300025919 Bacteria 1616
117 Ga0207657_10210389 3300025919 Unclassified 1561
118 Ga0207649_10416811 3300025920 Bacteria 1008
119 Ga0207652_10000098 3300025921 Bacteria 94858
120 Ga0207652_10001568 3300025921 Bacteria 20111
121 Ga0207652_10020974 3300025921 Bacteria 5389
122 Ga0207652_10168970 3300025921 Bacteria 1962
123 Ga0207650_10064954 3300025925 Bacteria 2733
124 Ga0207650_10654353 3300025925 Unclassified 886
125 Ga0207650_10789600 3300025925 Bacteria 804
126 Ga0207659_10202546 3300025926 Unclassified 1586
127 Ga0207659_10589997 3300025926 Bacteria 947
128 Ga0207664_10247362 3300025929 Bacteria 1555
129 Ga0207690_10036387 3300025932 Bacteria 3187
130 Ga0207690_10100652 3300025932 Unclassified 2063
131 Ga0207704_10178886 3300025938 Bacteria 1531
132 Ga0207689_10429852 3300025942 Bacteria 1102
133 Ga0207661_10101989 3300025944 Bacteria 2412
134 Ga0207661_10170645 3300025944 Bacteria 1894
135 Ga0207661_10254351 3300025944 Bacteria 1563
136 Ga0207667_10000451 3300025949 Bacteria 55109
137 Ga0207667_10010612 3300025949 Bacteria 10755
138 Ga0207667_10250968 3300025949 Bacteria 1810
139 Ga0207667_10463934 3300025949 Bacteria 1286
140 Ga0207651_10914890 3300025960 Bacteria 782
141 Ga0207640_10590235 3300025981 Bacteria 939
142 Ga0207658_11283761 3300025986 Unclassified 669
143 Ga0207639_10041961 3300026041 Bacteria 3427
144 Ga0207639_10513885 3300026041 Bacteria 1096
145 Ga0207678_10010109 3300026067 Bacteria 8276
146 Ga0207678_10064094 3300026067 Bacteria 3158
147 Ga0207702_10131428 3300026078 Bacteria 2253
148 Ga0207702_10350617 3300026078 Unclassified 1412
149 Ga0207641_10327525 3300026088 Bacteria 1454
150 Ga0207648_10545974 3300026089 Bacteria 1064
151 Ga0207674_10071896 3300026116 Bacteria 3475
152 Ga0207675_100113453 3300026118 Bacteria 2559
153 Ga0207683_10251316 3300026121 Bacteria 1613
154 Ga0207698_10135193 3300026142 Bacteria 2114
155 Ga0207698_10161501 3300026142 Bacteria 1960
156 Ga0207698_10578642 3300026142 Bacteria 1104
157 Ga0307414_10635163 3300032004 Bacteria 961
158 Ga0307411_10481215 3300032005 Bacteria 1045
159 Ga0395899_0016849 3300037312 Bacteria 5571
160 Ga0395899_0026525 3300037312 Unclassified 4372
161 Ga0395899_0053456 3300037312 Bacteria 2990
162 Ga0395899_0093278 3300037312 Unclassified 2179
163 Ga0395900_0001053 3300037418 Bacteria 35357
164 Ga0395900_0005684 3300037418 Bacteria 13039
165 Ga0395900_0081263 3300037418 Bacteria 3329
166 Ga0395900_0485859 3300037418 Bacteria 1187
167 Ga0395898_0001255 3300037466 Bacteria 37709
168 Ga0395898_0023358 3300037466 Bacteria 6249
169 Ga0395898_0170677 3300037466 Bacteria 2079
170 Ga0395898_0174988 3300037466 Bacteria 2051
171 Ga0395905_0926945 3300037471 Unclassified 774
172 Ga0395901_0001746 3300038443 Bacteria 22452
173 Ga0395901_0020599 3300038443 Bacteria 6749
174 Ga0395901_0082985 3300038443 Unclassified 3349
175 Ga0395901_0534583 3300038443 Unclassified 1189
176 Ga0439434_0210396 3300042435 Bacteria 658
177 Ga0453684_0610215 3300044712 Bacteria 1195
178 Ga0495670_0079204 3300046691 Bacteria 1672
179 Ga0495672_0048201 3300047320 Bacteria 2528
180 Ga0496108_0226566 3300048911 Bacteria 1625
181 Ga0496109_0334570 3300048912 Bacteria 1430
182 Ga0501034_0273542 3300049571 Bacteria 1630
183 Ga0501038_0396252 3300049574 Bacteria 1069
184 Ga0501070_0107948 3300049586 Bacteria 2300
185 Ga0501044_0208212 3300049823 Bacteria 1911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0079204 Ga0495670_0079204_219_800 184
2 3300005539 Ga0068853_100237020 Ga0068853_1002370202 190
3 3300025949 Ga0207667_10250968 Ga0207667_102509682 190
4 3300017792 Ga0163161_10658493 Ga0163161_106584931 192
5 3300005456 Ga0070678_100079422 Ga0070678_1000794223 193
6 3300005539 Ga0068853_100011101 Ga0068853_1000111014 193
7 3300026041 Ga0207639_10041961 Ga0207639_100419612 193
8 3300026078 Ga0207702_10131428 Ga0207702_101314282 193
9 3300025981 Ga0207640_10590235 Ga0207640_105902352 194
10 3300005577 Ga0068857_101195434 Ga0068857_1011954341 195
11 3300005331 Ga0070670_100830481 Ga0070670_1008304811 196
12 3300005354 Ga0070675_100282537 Ga0070675_1002825371 196
13 3300005456 Ga0070678_100247911 Ga0070678_1002479112 196
14 3300005459 Ga0068867_100332527 Ga0068867_1003325272 196
15 3300013308 Ga0157375_11343093 Ga0157375_113430931 196
16 3300025925 Ga0207650_10654353 Ga0207650_106543531 196
17 3300025926 Ga0207659_10202546 Ga0207659_102025461 196
18 3300025926 Ga0207659_10589997 Ga0207659_105899972 196
19 3300026121 Ga0207683_10251316 Ga0207683_102513161 196
20 3300032004 Ga0307414_10635163 Ga0307414_106351631 196
21 iso_pu_bacteria 2884634485 2884636590 197
22 3300005355 Ga0070671_100896881 Ga0070671_1008968811 198
23 3300005458 Ga0070681_10078020 Ga0070681_100780202 198
24 3300005578 Ga0068854_100488135 Ga0068854_1004881351 198
25 3300014326 Ga0157380_10616070 Ga0157380_106160702 198
26 3300025912 Ga0207707_10145694 Ga0207707_101456942 198
27 2162886012 MBSR1b_contig_12227882 MBSR1b_0823.00001980 199
28 3300003320 rootH2_10041737 rootH2_100417372 199
29 3300003323 rootH1_10219639 rootH1_102196391 199
30 3300005327 Ga0070658_10010500 Ga0070658_100105005 199
31 3300005327 Ga0070658_10067975 Ga0070658_100679752 199
32 3300005327 Ga0070658_10139912 Ga0070658_101399123 199
33 3300005327 Ga0070658_10420872 Ga0070658_104208721 199
34 3300005329 Ga0070683_100229964 Ga0070683_1002299642 199
35 3300005331 Ga0070670_100256501 Ga0070670_1002565011 199
36 3300005331 Ga0070670_100325165 Ga0070670_1003251651 199
37 3300005336 Ga0070680_100030654 Ga0070680_1000306543 199
38 3300005336 Ga0070680_100175490 Ga0070680_1001754903 199
39 3300005336 Ga0070680_100374589 Ga0070680_1003745891 199
40 3300005336 Ga0070680_100459774 Ga0070680_1004597742 199
41 3300005339 Ga0070660_100000242 Ga0070660_10000024214 199
42 3300005344 Ga0070661_100353679 Ga0070661_1003536792 199
43 3300005345 Ga0070692_10142407 Ga0070692_101424072 199
44 3300005354 Ga0070675_101050453 Ga0070675_1010504531 199
45 3300005365 Ga0070688_100570850 Ga0070688_1005708501 199
46 3300005366 Ga0070659_100119040 Ga0070659_1001190401 199
47 3300005366 Ga0070659_100139353 Ga0070659_1001393532 199
48 3300005366 Ga0070659_100645082 Ga0070659_1006450821 199
49 3300005367 Ga0070667_100596702 Ga0070667_1005967021 199
50 3300005435 Ga0070714_100317053 Ga0070714_1003170532 199
51 3300005455 Ga0070663_101037993 Ga0070663_1010379931 199
52 3300005458 Ga0070681_10135111 Ga0070681_101351112 199
53 3300005458 Ga0070681_10157998 Ga0070681_101579982 199
54 3300005458 Ga0070681_10190329 Ga0070681_101903292 199
55 3300005530 Ga0070679_100000103 Ga0070679_10000010331 199
56 3300005530 Ga0070679_100015017 Ga0070679_1000150171 199
57 3300005530 Ga0070679_100090937 Ga0070679_1000909373 199
58 3300005535 Ga0070684_100500402 Ga0070684_1005004021 199
59 3300005535 Ga0070684_100742256 Ga0070684_1007422561 199
60 3300005539 Ga0068853_100169004 Ga0068853_1001690043 199
61 3300005539 Ga0068853_100458623 Ga0068853_1004586232 199
62 3300005539 Ga0068853_100709843 Ga0068853_1007098431 199
63 3300005563 Ga0068855_100010851 Ga0068855_1000108517 199
64 3300005563 Ga0068855_100371289 Ga0068855_1003712891 199
65 3300005614 Ga0068856_100323714 Ga0068856_1003237142 199
66 3300005614 Ga0068856_100400775 Ga0068856_1004007752 199
67 3300005616 Ga0068852_100329031 Ga0068852_1003290312 199
68 3300005616 Ga0068852_100412385 Ga0068852_1004123852 199
69 3300005617 Ga0068859_100419345 Ga0068859_1004193452 199
70 3300005719 Ga0068861_100516981 Ga0068861_1005169811 199
71 3300005841 Ga0068863_100421794 Ga0068863_1004217942 199
72 3300005841 Ga0068863_100536975 Ga0068863_1005369752 199
73 3300005985 Ga0081539_10000622 Ga0081539_1000062252 199
74 3300006237 Ga0097621_100023305 Ga0097621_1000233053 199
75 3300006881 Ga0068865_100181319 Ga0068865_1001813193 199
76 3300006931 Ga0097620_100419361 Ga0097620_1004193612 199
77 3300009098 Ga0105245_10172001 Ga0105245_101720013 199
78 3300009098 Ga0105245_10331886 Ga0105245_103318863 199
79 3300009174 Ga0105241_10058293 Ga0105241_100582933 199
80 3300009176 Ga0105242_11471203 Ga0105242_114712031 199
81 3300009545 Ga0105237_10016797 Ga0105237_100167978 199
82 3300009553 Ga0105249_10456979 Ga0105249_104569792 199
83 3300013100 Ga0157373_10013181 Ga0157373_100131815 199
84 3300013100 Ga0157373_10037288 Ga0157373_100372884 199
85 3300013100 Ga0157373_10066521 Ga0157373_100665213 199
86 3300013100 Ga0157373_10532493 Ga0157373_105324932 199
87 3300013102 Ga0157371_10000418 Ga0157371_1000041838 199
88 3300013102 Ga0157371_10001753 Ga0157371_100017537 199
89 3300013102 Ga0157371_10003716 Ga0157371_100037169 199
90 3300013102 Ga0157371_10016749 Ga0157371_100167492 199
91 3300013102 Ga0157371_10069325 Ga0157371_100693252 199
92 3300013102 Ga0157371_10097337 Ga0157371_100973372 199
93 3300013102 Ga0157371_10129331 Ga0157371_101293312 199
94 3300013102 Ga0157371_10164309 Ga0157371_101643092 199
95 3300013102 Ga0157371_10483449 Ga0157371_104834492 199
96 3300013104 Ga0157370_10001052 Ga0157370_1000105234 199
97 3300013104 Ga0157370_10618671 Ga0157370_106186711 199
98 3300013105 Ga0157369_10024089 Ga0157369_100240894 199
99 3300013105 Ga0157369_10050636 Ga0157369_100506362 199
100 3300013105 Ga0157369_10112072 Ga0157369_101120723 199
101 3300013297 Ga0157378_10037684 Ga0157378_100376844 199
102 3300013297 Ga0157378_10780121 Ga0157378_107801212 199
103 3300013297 Ga0157378_11126061 Ga0157378_111260611 199
104 3300013306 Ga0163162_11157443 Ga0163162_111574431 199
105 3300013307 Ga0157372_10005977 Ga0157372_1000597712 199
106 3300013307 Ga0157372_10039945 Ga0157372_100399457 199
107 3300013307 Ga0157372_10203766 Ga0157372_102037662 199
108 3300013307 Ga0157372_10292292 Ga0157372_102922923 199
109 3300014325 Ga0163163_10321045 Ga0163163_103210452 199
110 3300014325 Ga0163163_10326971 Ga0163163_103269712 199
111 3300014968 Ga0157379_10230402 Ga0157379_102304021 199
112 3300014969 Ga0157376_10419076 Ga0157376_104190761 199
113 3300017792 Ga0163161_10093017 Ga0163161_100930172 199
114 3300025904 Ga0207647_10125478 Ga0207647_101254782 199
115 3300025907 Ga0207645_10320941 Ga0207645_103209411 199
116 3300025909 Ga0207705_10005765 Ga0207705_1000576511 199
117 3300025909 Ga0207705_10039831 Ga0207705_100398313 199
118 3300025909 Ga0207705_10109341 Ga0207705_101093412 199
119 3300025909 Ga0207705_10126840 Ga0207705_101268401 199
120 3300025909 Ga0207705_10263169 Ga0207705_102631691 199
121 3300025909 Ga0207705_10298808 Ga0207705_102988082 199
122 3300025912 Ga0207707_10030532 Ga0207707_100305325 199
123 3300025917 Ga0207660_10234259 Ga0207660_102342592 199
124 3300025919 Ga0207657_10001477 Ga0207657_1000147720 199
125 3300025919 Ga0207657_10010232 Ga0207657_100102322 199
126 3300025919 Ga0207657_10049017 Ga0207657_100490172 199
127 3300025919 Ga0207657_10198257 Ga0207657_101982571 199
128 3300025919 Ga0207657_10210389 Ga0207657_102103892 199
129 3300025920 Ga0207649_10416811 Ga0207649_104168112 199
130 3300025921 Ga0207652_10000098 Ga0207652_1000009816 199
131 3300025921 Ga0207652_10001568 Ga0207652_100015684 199
132 3300025921 Ga0207652_10020974 Ga0207652_100209741 199
133 3300025921 Ga0207652_10168970 Ga0207652_101689703 199
134 3300025925 Ga0207650_10064954 Ga0207650_100649545 199
135 3300025925 Ga0207650_10789600 Ga0207650_107896001 199
136 3300025929 Ga0207664_10247362 Ga0207664_102473622 199
137 3300025932 Ga0207690_10036387 Ga0207690_100363873 199
138 3300025932 Ga0207690_10100652 Ga0207690_101006522 199
139 3300025938 Ga0207704_10178886 Ga0207704_101788861 199
140 3300025942 Ga0207689_10429852 Ga0207689_104298521 199
141 3300025944 Ga0207661_10101989 Ga0207661_101019892 199
142 3300025944 Ga0207661_10170645 Ga0207661_101706452 199
143 3300025944 Ga0207661_10254351 Ga0207661_102543512 199
144 3300025949 Ga0207667_10000451 Ga0207667_100004517 199
145 3300025949 Ga0207667_10010612 Ga0207667_100106121 199
146 3300025949 Ga0207667_10463934 Ga0207667_104639342 199
147 3300025960 Ga0207651_10914890 Ga0207651_109148901 199
148 3300025986 Ga0207658_11283761 Ga0207658_112837611 199
149 3300026041 Ga0207639_10513885 Ga0207639_105138852 199
150 3300026067 Ga0207678_10010109 Ga0207678_100101095 199
151 3300026067 Ga0207678_10064094 Ga0207678_100640943 199
152 3300026078 Ga0207702_10350617 Ga0207702_103506171 199
153 3300026088 Ga0207641_10327525 Ga0207641_103275252 199
154 3300026089 Ga0207648_10545974 Ga0207648_105459742 199
155 3300026116 Ga0207674_10071896 Ga0207674_100718962 199
156 3300026118 Ga0207675_100113453 Ga0207675_1001134532 199
157 3300026142 Ga0207698_10135193 Ga0207698_101351932 199
158 3300026142 Ga0207698_10161501 Ga0207698_101615012 199
159 3300026142 Ga0207698_10578642 Ga0207698_105786422 199
160 3300032005 Ga0307411_10481215 Ga0307411_104812151 199
161 3300037312 Ga0395899_0016849 Ga0395899_0016849_3553_4152 199
162 3300037312 Ga0395899_0026525 Ga0395899_0026525_3348_3950 199
163 3300037312 Ga0395899_0053456 Ga0395899_0053456_14_613 199
164 3300037312 Ga0395899_0093278 Ga0395899_0093278_1117_1719 199
165 3300037418 Ga0395900_0001053 Ga0395900_0001053_13953_14552 199
166 3300037418 Ga0395900_0005684 Ga0395900_0005684_931_1530 199
167 3300037418 Ga0395900_0081263 Ga0395900_0081263_1566_2165 199
168 3300037418 Ga0395900_0485859 Ga0395900_0485859_423_1022 199
169 3300037466 Ga0395898_0001255 Ga0395898_0001255_10742_11341 199
170 3300037466 Ga0395898_0023358 Ga0395898_0023358_5109_5711 199
171 3300037466 Ga0395898_0170677 Ga0395898_0170677_719_1318 199
172 3300037466 Ga0395898_0174988 Ga0395898_0174988_13_732 199
173 3300037471 Ga0395905_0926945 Ga0395905_0926945_23_622 199
174 3300038443 Ga0395901_0001746 Ga0395901_0001746_9265_9864 199
175 3300038443 Ga0395901_0020599 Ga0395901_0020599_1685_2404 199
176 3300038443 Ga0395901_0082985 Ga0395901_0082985_178_780 199
177 3300038443 Ga0395901_0534583 Ga0395901_0534583_292_894 199
178 3300042435 Ga0439434_0210396 Ga0439434_0210396_18_620 199
179 3300044712 Ga0453684_0610215 Ga0453684_0610215_246_845 199
180 3300047320 Ga0495672_0048201 Ga0495672_0048201_738_1337 199
181 3300048911 Ga0496108_0226566 Ga0496108_0226566_294_893 199
182 3300048912 Ga0496109_0334570 Ga0496109_0334570_628_1227 199
183 3300049571 Ga0501034_0273542 Ga0501034_0273542_16_615 199
184 3300049574 Ga0501038_0396252 Ga0501038_0396252_39_644 199
185 3300049586 Ga0501070_0107948 Ga0501070_0107948_799_1521 199
186 3300049823 Ga0501044_0208212 Ga0501044_0208212_1019_1642 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

78

174

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pc1-assembly2.cif.gz_C crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.6353 25 132
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5856 28 197
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5727 28 197
7eiv-assembly1.cif.gz_D heterotetrameric glycyl-trna synthetase from escherichia coli 0.5557 25 193
8h1c-assembly1.cif.gz_B cryo-em structure of oryza sativa plastid glycyl-trna synthetase in complex with two trnas (one in trna binding state and the other in trna locked state) 0.5463 25 191
ID Description Score Start End Superfamily
af_Q58247_43_183_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7186 37 131 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.623 23 170 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.596 23 170 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5362 22 193 1.10.3210.10
af_Q2G297_1_187_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5174 20 199 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A4U3L917-F1-model_v4 Hydrolase 0.9991 1 199 GO:0016787
AF-A0A6J4HLS0-F1-model_v4 Uncharacterized domain HDIG 0.9927 2 199
AF-A0A4Q5UT35-F1-model_v4 deleted 0.9909 69 199
AF-G8T7K9-F1-model_v4 HD domain-containing protein 0.9881 2 199
AF-V5WKA3-F1-model_v4 HDIG domain protein 0.9872 2 199

Feature Viewer

pLDDT pTM Quality
96.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map