F286487

General Info

Members Datasets Scaffolds Average Seq Length
186 125 372 359

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0068823|Ga0495629_0068823_1250_2224
Length 324
Sequence MRRAMAEAEVGDDVYLEDPTAKALERRAAEIFGKEAALFVPTGCMGNLIAIKVWTHHGDEVICEERSHVNLYELASMSAIAGCMPRTALGEDGILTWSQIESLIRPKIYYDSQTALVCLENSHNMAGGTLYTTAQVNDICDHAHAAGLKVHLDGARVFNAAVALNLDSVMFCLSKGLGAPVGSMIVGSSAFVEKARIYRKMFGGGMRQVGVLAAAGRIALEESPKRLAIDHQNAKRLAEGIAQIPALRIDPAKVVTNIVIFDCRESCMNAVQFCDALKLHGIGALDTAQYSVRFVTHCDVDAAGMDRALQVVGQVVSKSLGSAA

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0068823 3300046459 Bacteria 2470
2 Ga0065707_10002165 3300005295 Bacteria 12899
3 Ga0070669_100051927 3300005353 Bacteria 2998
4 Ga0070675_100328471 3300005354 Bacteria 1352
5 Ga0070709_10141780 3300005434 Bacteria 1652
6 Ga0070714_100138376 3300005435 Bacteria 2183
7 Ga0070713_100006966 3300005436 Bacteria 7892
8 Ga0070713_100025215 3300005436 Bacteria 4646
9 Ga0070711_100091387 3300005439 Bacteria 2194
10 Ga0070711_100133151 3300005439 Bacteria 1854
11 Ga0070694_100006877 3300005444 Bacteria 6913
12 Ga0070708_100093200 3300005445 Bacteria 2745
13 Ga0070708_100114534 3300005445 Bacteria 2481
14 Ga0070706_100001335 3300005467 Bacteria 26240
15 Ga0070706_100054661 3300005467 Bacteria 3685
16 Ga0070707_100001017 3300005468 Bacteria 27791
17 Ga0070707_100013198 3300005468 Bacteria 7722
18 Ga0070707_100016120 3300005468 Bacteria 7013
19 Ga0070707_100203453 3300005468 Bacteria 1930
20 Ga0070698_100001826 3300005471 Bacteria 23699
21 Ga0070698_100005301 3300005471 Bacteria 14107
22 Ga0070698_100017659 3300005471 Bacteria 7516
23 Ga0070698_100088516 3300005471 Bacteria 3081
24 Ga0070699_100012591 3300005518 Bacteria 7296
25 Ga0070699_100061272 3300005518 Bacteria 3261
26 Ga0070697_100000869 3300005536 Bacteria 22726
27 Ga0070697_100066082 3300005536 Bacteria 2957
28 Ga0070695_100000390 3300005545 Bacteria 22764
29 Ga0070696_100002161 3300005546 Bacteria 12951
30 Ga0070693_100000095 3300005547 Bacteria 38467
31 Ga0068862_100010044 3300005844 Bacteria 7817
32 Ga0070716_100007833 3300006173 Bacteria 5280
33 Ga0070716_100011274 3300006173 Bacteria 4501
34 Ga0070716_100024058 3300006173 Bacteria 3238
35 Ga0070716_100082125 3300006173 Bacteria 1926
36 Ga0070712_100103336 3300006175 Bacteria 2112
37 Ga0097621_100289061 3300006237 Archaea 1445
38 Ga0068871_100216425 3300006358 Bacteria 1658
39 Ga0075428_100000229 3300006844 Bacteria 54643
40 Ga0075428_100015678 3300006844 Bacteria 8398
41 Ga0075431_100042512 3300006847 Bacteria 4688
42 Ga0075431_100119106 3300006847 Bacteria 2724
43 Ga0075433_10015019 3300006852 Bacteria 6340
44 Ga0075433_10182776 3300006852 Bacteria 1866
45 Ga0075434_100019699 3300006871 Bacteria 6531
46 Ga0075429_100060223 3300006880 Bacteria 3307
47 Ga0068865_100194958 3300006881 Bacteria 1569
48 Ga0075436_100068473 3300006914 Bacteria 2452
49 Ga0075435_100031284 3300007076 Bacteria 4190
50 Ga0075435_100041972 3300007076 Bacteria 3658
51 Ga0075435_100070030 3300007076 Bacteria 2862
52 Ga0075435_100108523 3300007076 Bacteria 2306
53 Ga0099794_10009616 3300007265 Bacteria 4075
54 Ga0099794_10014678 3300007265 Bacteria 3438
55 Ga0099794_10044257 3300007265 Bacteria 2127
56 Ga0099794_10123683 3300007265 Bacteria 1303
57 Ga0111539_10000008 3300009094 Bacteria 382609
58 Ga0105247_10024838 3300009101 Bacteria 3612
59 Ga0114129_10003994 3300009147 Bacteria 20838
60 Ga0114129_10036940 3300009147 Bacteria 6897
61 Ga0105242_10005499 3300009176 Bacteria 9781
62 Ga0105249_10014423 3300009553 Bacteria 6987
63 Ga0105249_10044604 3300009553 Bacteria 4031
64 Ga0105239_10077207 3300010375 Bacteria 3665
65 Ga0157378_10000112 3300013297 Bacteria 77866
66 Ga0157378_10154039 3300013297 Bacteria 2143
67 Ga0157372_10025917 3300013307 Bacteria 6377
68 Ga0157375_10041054 3300013308 Bacteria 4465
69 Ga0157380_10018029 3300014326 Bacteria 5236
70 Ga0157379_10036418 3300014968 Bacteria 4388
71 Ga0157376_10000004 3300014969 Bacteria 508493
72 Ga0213875_10010862 3300021388 Bacteria 4553
73 Ga0207710_10040664 3300025900 Unclassified 2060
74 Ga0207685_10019703 3300025905 Bacteria 2227
75 Ga0207699_10001552 3300025906 Bacteria 10883
76 Ga0207699_10028032 3300025906 Bacteria 3125
77 Ga0207699_10057848 3300025906 Bacteria 2317
78 Ga0207684_10006364 3300025910 Bacteria 10763
79 Ga0207684_10020462 3300025910 Bacteria 5654
80 Ga0207693_10012952 3300025915 Bacteria 6730
81 Ga0207693_10099053 3300025915 Bacteria 2286
82 Ga0207663_10011017 3300025916 Bacteria 4836
83 Ga0207646_10000046 3300025922 Bacteria 177239
84 Ga0207646_10004238 3300025922 Bacteria 15671
85 Ga0207646_10072917 3300025922 Bacteria 3067
86 Ga0207646_10217153 3300025922 Bacteria 1727
87 Ga0207681_10029645 3300025923 Bacteria 3558
88 Ga0207700_10125876 3300025928 Bacteria 2085
89 Ga0207664_10131284 3300025929 Bacteria 2109
90 Ga0207706_10075468 3300025933 Bacteria 2965
91 Ga0207665_10000290 3300025939 Bacteria 34797
92 Ga0207665_10005712 3300025939 Bacteria 8286
93 Ga0207703_10039228 3300026035 Bacteria 3784
94 Ga0209179_1010529 3300027512 Bacteria 1615
95 Ga0209588_1003481 3300027671 Bacteria 4369
96 Ga0207428_10000285 3300027907 Bacteria 68342
97 Ga0265354_1002632 3300028016 Unclassified 2180
98 Ga0268266_10000470 3300028379 Bacteria 58333
99 Ga0268264_10137458 3300028381 Bacteria 2174
100 Ga0265340_10069690 3300031247 Unclassified 1669
101 Ga0307411_10146825 3300032005 Bacteria 1747
102 Ga0373934_0001158 3300035086 Bacteria 9613
103 Ga0373953_0121128 3300035117 Unclassified 1111
104 Ga0373954_0032141 3300035118 Bacteria 2425
105 Ga0373956_0021322 3300035119 Bacteria 2764
106 Ga0373955_0007488 3300035172 Bacteria 5019
107 Ga0373924_0022870 3300035410 Bacteria 2447
108 Ga0373931_0142163 3300035691 Bacteria 1391
109 Ga0373927_0002230 3300035695 Bacteria 14230
110 Ga0373927_0016861 3300035695 Bacteria 4817
111 Ga0373933_0000868 3300035724 Bacteria 18538
112 Ga0373947_0014808 3300035725 Bacteria 4475
113 Ga0373937_0035371 3300036401 Bacteria 4546
114 Ga0373937_0267438 3300036401 Bacteria 1613
115 Ga0373925_0001028 3300037068 Bacteria 25267
116 Ga0373925_0358414 3300037068 Bacteria 1185
117 Ga0451577_0043771 3300042876 Bacteria 4009
118 Ga0451577_0099947 3300042876 Bacteria 2591
119 Ga0453683_0010233 3300044673 Bacteria 6223
120 Ga0453683_0053230 3300044673 Bacteria 2533
121 Ga0453684_0069330 3300044712 Bacteria 4473
122 Ga0453684_0626956 3300044712 Bacteria 1175
123 Ga0451576_0068978 3300045051 Bacteria 3679
124 Ga0495592_0026630 3300046454 Bacteria 4383
125 Ga0495603_0008657 3300046455 Bacteria 6150
126 Ga0495651_0027998 3300046462 Bacteria 4393
127 Ga0495651_0038406 3300046462 Bacteria 3728
128 Ga0495580_0009738 3300046472 Bacteria 7538
129 Ga0495580_0092159 3300046472 Bacteria 2109
130 Ga0495580_0098194 3300046472 Bacteria 2037
131 Ga0495582_0000273 3300046473 Bacteria 28761
132 Ga0495639_0048687 3300046475 Bacteria 1922
133 Ga0495594_0126643 3300046499 Bacteria 1445
134 Ga0495608_0014167 3300046511 Bacteria 5533
135 Ga0495630_0066938 3300046517 Bacteria 2700
136 Ga0495642_0110129 3300046528 Bacteria 1177
137 Ga0495652_0055164 3300046529 Unclassified 3381
138 Ga0495640_0004546 3300046533 Bacteria 11063
139 Ga0495645_0022489 3300046543 Bacteria 4562
140 Ga0495645_0107238 3300046543 Bacteria 1980
141 Ga0495667_0006416 3300046559 Bacteria 7978
142 Ga0495667_0117270 3300046559 Bacteria 1720
143 Ga0495635_0029798 3300046663 Bacteria 3796
144 Ga0495657_0064083 3300046675 Unclassified 2422
145 Ga0495646_0158046 3300046680 Bacteria 1257
146 Ga0495647_0024359 3300046681 Bacteria 2202
147 Ga0495658_0008422 3300046683 Bacteria 5111
148 Ga0495658_0012820 3300046683 Bacteria 4256
149 Ga0495613_0034795 3300046689 Unclassified 3740
150 Ga0495604_0000263 3300047317 Bacteria 46727
151 Ga0495674_0083020 3300047319 Bacteria 2747
152 Ga0495676_0057374 3300047321 Bacteria 3072
153 Ga0495676_0262411 3300047321 Unclassified 1175
154 Ga0495675_0038363 3300047444 Bacteria 3050
155 Ga0495684_0057483 3300047471 Bacteria 2964
156 Ga0495684_0104434 3300047471 Bacteria 2141
157 Ga0495684_0115177 3300047471 Bacteria 2027
158 Ga0496102_0047037 3300048905 Bacteria 3919
159 Ga0496104_0167186 3300048907 Bacteria 2109
160 Ga0496105_0047060 3300048908 Bacteria 3560
161 Ga0496114_0022838 3300048917 Bacteria 5099
162 Ga0496115_0002349 3300048918 Bacteria 13572
163 Ga0496115_0027305 3300048918 Bacteria 4463
164 Ga0501040_0076095 3300049576 Bacteria 2321
165 Ga0501074_0051751 3300049590 Bacteria 2964
166 Ga0501045_0027837 3300049824 Bacteria 4076
167 nmdc:mga05p37_12073_c1 3300050507 Bacteria 10311
168 nmdc:mga09592_139272_c1 3300050508 Unclassified 2090
169 nmdc:mga09592_217364_c1 3300050508 Bacteria 1656
170 nmdc:mga06r32_202348_c1 3300050510 Bacteria 1973
171 nmdc:mga06r32_35538_c1 3300050510 Bacteria 4702
172 nmdc:mga06r32_67556_c1 3300050510 Bacteria 3451
173 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
174 nmdc:mga0n895_161138_c1 3300050512 Bacteria 2275
175 nmdc:mga0n895_4680_c1 3300050512 Bacteria 11287
176 nmdc:mga0n895_72256_c1 3300050512 Bacteria 3422
177 nmdc:mga0rr50_238274_c1 3300050513 Bacteria 1507
178 nmdc:mga0rr50_29026_c1 3300050513 Bacteria 3895
179 nmdc:mga0rr50_58781_c1 3300050513 Bacteria 2883
180 nmdc:mga08x19_16173_c1 3300050514 Bacteria 4547
181 nmdc:mga08x19_43768_c1 3300050514 Bacteria 2856
182 nmdc:mga08x19_495_c1 3300050514 Bacteria 26239
183 nmdc:mga0a205_244998_c1 3300050515 Bacteria 1673
184 nmdc:mga0a205_5688_c1 3300050515 Bacteria 11230
185 Ga0495619_0027074 3300053085 Bacteria 3693
186 Ga0530510_0165358 3300061734 Bacteria 1637
187 Ga0495629_0068823
188 Ga0065707_10002165
189 Ga0070669_100051927
190 Ga0070675_100328471
191 Ga0070709_10141780
192 Ga0070714_100138376
193 Ga0070713_100006966
194 Ga0070713_100025215
195 Ga0070711_100091387
196 Ga0070711_100133151
197 Ga0070694_100006877
198 Ga0070708_100093200
199 Ga0070708_100114534
200 Ga0070706_100001335
201 Ga0070706_100054661
202 Ga0070707_100001017
203 Ga0070707_100013198
204 Ga0070707_100016120
205 Ga0070707_100203453
206 Ga0070698_100001826
207 Ga0070698_100005301
208 Ga0070698_100017659
209 Ga0070698_100088516
210 Ga0070699_100012591
211 Ga0070699_100061272
212 Ga0070697_100000869
213 Ga0070697_100066082
214 Ga0070695_100000390
215 Ga0070696_100002161
216 Ga0070693_100000095
217 Ga0068862_100010044
218 Ga0070716_100007833
219 Ga0070716_100011274
220 Ga0070716_100024058
221 Ga0070716_100082125
222 Ga0070712_100103336
223 Ga0097621_100289061
224 Ga0068871_100216425
225 Ga0075428_100000229
226 Ga0075428_100015678
227 Ga0075431_100042512
228 Ga0075431_100119106
229 Ga0075433_10015019
230 Ga0075433_10182776
231 Ga0075434_100019699
232 Ga0075429_100060223
233 Ga0068865_100194958
234 Ga0075436_100068473
235 Ga0075435_100031284
236 Ga0075435_100041972
237 Ga0075435_100070030
238 Ga0075435_100108523
239 Ga0099794_10009616
240 Ga0099794_10014678
241 Ga0099794_10044257
242 Ga0099794_10123683
243 Ga0111539_10000008
244 Ga0105247_10024838
245 Ga0114129_10003994
246 Ga0114129_10036940
247 Ga0105242_10005499
248 Ga0105249_10014423
249 Ga0105249_10044604
250 Ga0105239_10077207
251 Ga0157378_10000112
252 Ga0157378_10154039
253 Ga0157372_10025917
254 Ga0157375_10041054
255 Ga0157380_10018029
256 Ga0157379_10036418
257 Ga0157376_10000004
258 Ga0213875_10010862
259 Ga0207710_10040664
260 Ga0207685_10019703
261 Ga0207699_10001552
262 Ga0207699_10028032
263 Ga0207699_10057848
264 Ga0207684_10006364
265 Ga0207684_10020462
266 Ga0207693_10012952
267 Ga0207693_10099053
268 Ga0207663_10011017
269 Ga0207646_10000046
270 Ga0207646_10004238
271 Ga0207646_10072917
272 Ga0207646_10217153
273 Ga0207681_10029645
274 Ga0207700_10125876
275 Ga0207664_10131284
276 Ga0207706_10075468
277 Ga0207665_10000290
278 Ga0207665_10005712
279 Ga0207703_10039228
280 Ga0209179_1010529
281 Ga0209588_1003481
282 Ga0207428_10000285
283 Ga0265354_1002632
284 Ga0268266_10000470
285 Ga0268264_10137458
286 Ga0265340_10069690
287 Ga0307411_10146825
288 Ga0373934_0001158
289 Ga0373953_0121128
290 Ga0373954_0032141
291 Ga0373956_0021322
292 Ga0373955_0007488
293 Ga0373924_0022870
294 Ga0373931_0142163
295 Ga0373927_0002230
296 Ga0373927_0016861
297 Ga0373933_0000868
298 Ga0373947_0014808
299 Ga0373937_0035371
300 Ga0373937_0267438
301 Ga0373925_0001028
302 Ga0373925_0358414
303 Ga0451577_0043771
304 Ga0451577_0099947
305 Ga0453683_0010233
306 Ga0453683_0053230
307 Ga0453684_0069330
308 Ga0453684_0626956
309 Ga0451576_0068978
310 Ga0495592_0026630
311 Ga0495603_0008657
312 Ga0495651_0027998
313 Ga0495651_0038406
314 Ga0495580_0009738
315 Ga0495580_0092159
316 Ga0495580_0098194
317 Ga0495582_0000273
318 Ga0495639_0048687
319 Ga0495594_0126643
320 Ga0495608_0014167
321 Ga0495630_0066938
322 Ga0495642_0110129
323 Ga0495652_0055164
324 Ga0495640_0004546
325 Ga0495645_0022489
326 Ga0495645_0107238
327 Ga0495667_0006416
328 Ga0495667_0117270
329 Ga0495635_0029798
330 Ga0495657_0064083
331 Ga0495646_0158046
332 Ga0495647_0024359
333 Ga0495658_0008422
334 Ga0495658_0012820
335 Ga0495613_0034795
336 Ga0495604_0000263
337 Ga0495674_0083020
338 Ga0495676_0057374
339 Ga0495676_0262411
340 Ga0495675_0038363
341 Ga0495684_0057483
342 Ga0495684_0104434
343 Ga0495684_0115177
344 Ga0496102_0047037
345 Ga0496104_0167186
346 Ga0496105_0047060
347 Ga0496114_0022838
348 Ga0496115_0002349
349 Ga0496115_0027305
350 Ga0501040_0076095
351 Ga0501074_0051751
352 Ga0501045_0027837
353 nmdc:mga05p37_12073_c1
354 nmdc:mga09592_139272_c1
355 nmdc:mga09592_217364_c1
356 nmdc:mga06r32_202348_c1
357 nmdc:mga06r32_35538_c1
358 nmdc:mga06r32_67556_c1
359 nmdc:mga08y16_17_c1
360 nmdc:mga0n895_161138_c1
361 nmdc:mga0n895_4680_c1
362 nmdc:mga0n895_72256_c1
363 nmdc:mga0rr50_238274_c1
364 nmdc:mga0rr50_29026_c1
365 nmdc:mga0rr50_58781_c1
366 nmdc:mga08x19_16173_c1
367 nmdc:mga08x19_43768_c1
368 nmdc:mga08x19_495_c1
369 nmdc:mga0a205_244998_c1
370 nmdc:mga0a205_5688_c1
371 Ga0495619_0027074
372 Ga0530510_0165358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01212

Beta_elim_lyase

Beta-eliminating lyase

1

264

0.98

PF00155

Aminotran_1_2

Aminotransferase class I and II

2

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jg8-assembly1.cif.gz_C crystal structure of threonine aldolase (low-specificity) 0.9831 4 343
3wgb-assembly1.cif.gz_B crystal structure of aeromonas jandaei l-allo-threonine aldolase 0.9735 4 340
1jg8-assembly1.cif.gz_A crystal structure of threonine aldolase (low-specificity) 0.9711 4 343
1jg8-assembly1.cif.gz_C crystal structure of threonine aldolase (low-specificity) 0.9689 4 343
3wgc-assembly1.cif.gz_D aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant 0.9679 3 340
ID Description Score Start End Superfamily
1jg8A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9834 4 248 3.40.640.10
af_A0A1D6EP40_204_303_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9777 148 246 3.40.640.10
1jg8A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9755 4 248 3.40.640.10
af_A0A1D6E671_253_349_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9687 251 343 3.90.1150.10
1jg8A02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9634 251 343 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3M1WC24-F1-model_v4 Low specificity L-threonine aldolase 0.9913 1 209 GO:0005829
GO:0006545
GO:0006567
GO:0008732
AF-A0A2M7ZHP3-F1-model_v4 Low specificity L-threonine aldolase 0.9888 1 265 GO:0005829
GO:0006545
GO:0006567
GO:0008732
AF-A0A522TFK1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9874 2 343 GO:0005829
GO:0006545
GO:0006567
GO:0008483
GO:0008732
AF-A0A2W4KMV1-F1-model_v4 Low specificity L-threonine aldolase 0.9872 1 342 GO:0005829
GO:0006545
GO:0006567
GO:0008732
AF-A0A833EQ44-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9856 4 304 GO:0005829
GO:0006545
GO:0006567
GO:0008483
GO:0008732

Map