F286433

General Info

Members Datasets Scaffolds Average Seq Length
186 127 183 172

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0199490|Ga0466964_0199490_177_761
Length 194
Sequence MIELELTNLANRFNDCTQSLYSMLMLGKDYDRQDCSLARALEVVGERWTLLVVRDAFYGVRRFNDFQAHLDIPKAILSERLSSLVENGILERRQDHQHAGRQLYELTSAGRDLWPALNALLAWGDRHRFPNGRLFKHADCATRLDASGYCSICEVTPGPEAIISEPRPDRRPVRDDPVAIALRGPRRLLDPIET

Samples

Sample ID Description Type Environment
1 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
2 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
50 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
51 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100309238 3300005344 Bacteria 1232
2 Ga0070674_100522002 3300005356 Bacteria 992
3 Ga0070709_11041386 3300005434 Bacteria 652
4 Ga0070714_100045234 3300005435 Bacteria 3730
5 Ga0070714_100059502 3300005435 Bacteria 3276
6 Ga0070714_100365545 3300005435 Bacteria 1357
7 Ga0070714_100525232 3300005435 Bacteria 1131
8 Ga0070713_100062340 3300005436 Bacteria 3123
9 Ga0070713_100114085 3300005436 Bacteria 2360
10 Ga0070713_100377804 3300005436 Bacteria 1319
11 Ga0070710_10020148 3300005437 Bacteria 3456
12 Ga0070710_10389504 3300005437 Unclassified 931
13 Ga0070710_10566778 3300005437 Bacteria 786
14 Ga0070711_100230522 3300005439 Unclassified 1444
15 Ga0070700_100416721 3300005441 Bacteria 1014
16 Ga0070662_100031394 3300005457 Bacteria 3728
17 Ga0068853_100402224 3300005539 Bacteria 1282
18 Ga0068854_100844496 3300005578 Bacteria 801
19 Ga0068866_10583396 3300005718 Bacteria 752
20 Ga0068861_100769404 3300005719 Bacteria 901
21 Ga0081455_10000245 3300005937 Bacteria 70654
22 Ga0081455_10152382 3300005937 Bacteria 1781
23 Ga0081455_10209111 3300005937 Unclassified 1455
24 Ga0081455_10316450 3300005937 Bacteria 1113
25 Ga0081455_10476297 3300005937 Bacteria 845
26 Ga0081540_1002232 3300005983 Bacteria 15955
27 Ga0081539_10163518 3300005985 Bacteria 1059
28 Ga0070717_10020610 3300006028 Bacteria 5188
29 Ga0070717_10044587 3300006028 Bacteria 3622
30 Ga0070717_10067935 3300006028 Bacteria 2967
31 Ga0070717_11290690 3300006028 Bacteria 664
32 Ga0070716_100128529 3300006173 Unclassified 1598
33 Ga0070712_100047804 3300006175 Unclassified 2963
34 Ga0070712_100561968 3300006175 Bacteria 962
35 Ga0075430_100018312 3300006846 Bacteria 5961
36 Ga0075431_100021173 3300006847 Bacteria 6645
37 Ga0075431_101398575 3300006847 Bacteria 659
38 Ga0075433_10111505 3300006852 Bacteria 2427
39 Ga0075429_100024282 3300006880 Bacteria 5259
40 Ga0105240_12291105 3300009093 Bacteria 559
41 Ga0111539_10071358 3300009094 Bacteria 4098
42 Ga0111539_10396859 3300009094 Bacteria 1606
43 Ga0111539_12032780 3300009094 Bacteria 666
44 Ga0105245_10407486 3300009098 Bacteria 1360
45 Ga0114129_10005718 3300009147 Bacteria 17618
46 Ga0105249_11068457 3300009553 Bacteria 877
47 Ga0163163_10768301 3300014325 Bacteria 1027
48 Ga0213876_10005629 3300021384 Bacteria 6878
49 Ga0213875_10102339 3300021388 Bacteria 1337
50 Ga0207692_10046716 3300025898 Bacteria 2171
51 Ga0207699_10186897 3300025906 Unclassified 1396
52 Ga0207693_10001903 3300025915 Bacteria 18266
53 Ga0207663_10630601 3300025916 Unclassified 844
54 Ga0207687_10441080 3300025927 Bacteria 1078
55 Ga0207700_10021692 3300025928 Bacteria 4390
56 Ga0207700_10600174 3300025928 Bacteria 980
57 Ga0207700_10603217 3300025928 Bacteria 977
58 Ga0207664_10031269 3300025929 Bacteria 4071
59 Ga0207664_10049603 3300025929 Bacteria 3306
60 Ga0207664_10140881 3300025929 Bacteria 2040
61 Ga0207664_10906037 3300025929 Bacteria 792
62 Ga0207669_10482690 3300025937 Bacteria 988
63 Ga0207665_10055986 3300025939 Archaea 2662
64 Ga0207712_10552947 3300025961 Bacteria 990
65 Ga0207678_10114554 3300026067 Bacteria 2300
66 Ga0207675_100611182 3300026118 Bacteria 1094
67 Ga0207428_10007647 3300027907 Bacteria 9840
68 Ga0307413_10121257 3300031824 Unclassified 1772
69 Ga0307415_100407257 3300032126 Bacteria 1163
70 Ga0373953_0044182 3300035117 Unclassified 1781
71 Ga0373956_0129218 3300035119 Unclassified 1182
72 Ga0373933_0147316 3300035724 Unclassified 1489
73 Ga0373937_0351808 3300036401 Unclassified 1395
74 Ga0373937_0414770 3300036401 Bacteria 1278
75 Ga0316582_0164930 3300036647 Bacteria 1502
76 Ga0373925_0931939 3300037068 Bacteria 716
77 Ga0395900_0867713 3300037418 Bacteria 827
78 Ga0395898_1292313 3300037466 Bacteria 659
79 Ga0436364_0182925 3300037853 Bacteria 1725
80 Ga0436364_0797693 3300037853 Bacteria 5704
81 Ga0436364_1098086 3300037853 Bacteria 4140
82 Ga0436364_1156881 3300037853 Bacteria 1548
83 Ga0436364_1536816 3300037853 Bacteria 1759
84 Ga0395901_0273055 3300038443 Bacteria 1758
85 Ga0395901_0751489 3300038443 Bacteria 968
86 Ga0436365_0094735 3300039437 Bacteria 14452
87 Ga0436365_1509531 3300039437 Bacteria 965
88 Ga0436363_1378490 3300039450 Unclassified 765
89 Ga0436362_0556454 3300039453 Bacteria 2086
90 Ga0466966_0448593 3300044684 Unclassified 775
91 Ga0466961_0059700 3300044693 Bacteria 2425
92 Ga0466963_0005833 3300044694 Bacteria 7248
93 Ga0466963_0031605 3300044694 Bacteria 3423
94 Ga0466963_0051496 3300044694 Bacteria 2729
95 Ga0466963_0170913 3300044694 Bacteria 1515
96 Ga0466964_0104071 3300044706 Bacteria 1256
97 Ga0466964_0199490 3300044706 Bacteria 960
98 Ga0466971_0000320 3300044719 Bacteria 18485
99 Ga0466971_0063780 3300044719 Unclassified 1668
100 Ga0466968_0050742 3300044735 Unclassified 1771
101 Ga0466959_0006226 3300045049 Bacteria 8247
102 Ga0466959_0030772 3300045049 Bacteria 3974
103 Ga0466959_0080329 3300045049 Bacteria 2351
104 Ga0466959_0286054 3300045049 Bacteria 1131
105 Ga0466958_0032410 3300045836 Bacteria 3108
106 Ga0466958_0073076 3300045836 Bacteria 2101
107 Ga0466958_0154573 3300045836 Unclassified 1448
108 Ga0466958_0462318 3300045836 Bacteria 822
109 Ga0466967_0058924 3300045976 Bacteria 3396
110 Ga0466967_0077958 3300045976 Bacteria 2984
111 Ga0466967_0088883 3300045976 Bacteria 2804
112 Ga0466967_0476810 3300045976 Bacteria 1222
113 Ga0495592_0059721 3300046454 Bacteria 2807
114 Ga0495592_0332349 3300046454 Unclassified 979
115 Ga0495641_0272776 3300046461 Bacteria 761
116 Ga0495651_0003583 3300046462 Bacteria 11916
117 Ga0495653_0232083 3300046463 Unclassified 1234
118 Ga0495608_0001330 3300046511 Bacteria 17616
119 Ga0495608_0243542 3300046511 Bacteria 1123
120 Ga0495618_0095988 3300046514 Archaea 1896
121 Ga0495628_0052849 3300046516 Bacteria 3208
122 Ga0495652_0062403 3300046529 Bacteria 3142
123 Ga0495652_0143216 3300046529 Archaea 1877
124 Ga0495587_0142520 3300046536 Unclassified 1367
125 Ga0495667_0010746 3300046559 Bacteria 6191
126 Ga0495634_0208383 3300046642 Unclassified 1211
127 Ga0495657_0571394 3300046675 Unclassified 655
128 Ga0495599_0105572 3300046678 Bacteria 1755
129 Ga0495646_0040900 3300046680 Bacteria 2851
130 Ga0495613_0390875 3300046689 Unclassified 950
131 Ga0495581_0247491 3300047315 Unclassified 1042
132 Ga0495604_0338427 3300047317 Unclassified 1002
133 Ga0495674_0085877 3300047319 Bacteria 2695
134 Ga0495674_0132781 3300047319 Bacteria 2097
135 Ga0495674_0173716 3300047319 Bacteria 1797
136 Ga0495680_0232890 3300047322 Bacteria 1311
137 Ga0495680_0661132 3300047322 Unclassified 693
138 Ga0495675_0092846 3300047444 Unclassified 1894
139 Ga0495684_0060438 3300047471 Bacteria 2885
140 Ga0495593_0206773 3300047673 Unclassified 986
141 Ga0495602_0072564 3300048088 Archaea 2934
142 Ga0495602_0560844 3300048088 Bacteria 790
143 Ga0496100_0989540 3300048903 Bacteria 662
144 Ga0496109_0144409 3300048912 Archaea 2226
145 Ga0496109_1322004 3300048912 Bacteria 657
146 Ga0496110_0306476 3300048913 Bacteria 1446
147 Ga0496114_0229910 3300048917 Bacteria 1629
148 Ga0501031_0068109 3300049568 Bacteria 2319
149 Ga0501034_0268333 3300049571 Bacteria 1648
150 Ga0501036_0021534 3300049572 Bacteria 5420
151 Ga0501037_0015820 3300049573 Bacteria 5552
152 Ga0501038_0346271 3300049574 Bacteria 1158
153 Ga0501040_0087724 3300049576 Bacteria 2160
154 Ga0501042_0488820 3300049578 Bacteria 893
155 Ga0501043_0448172 3300049579 Bacteria 970
156 Ga0501043_0539025 3300049579 Bacteria 868
157 Ga0501047_0060362 3300049581 Bacteria 3660
158 Ga0501047_0153821 3300049581 Bacteria 2174
159 Ga0501067_0218213 3300049583 Bacteria 1062
160 Ga0501070_0210871 3300049586 Bacteria 1594
161 Ga0501073_0078647 3300049589 Bacteria 2295
162 Ga0501075_0351159 3300049591 Bacteria 1124
163 Ga0501077_0342057 3300049593 Bacteria 954
164 Ga0501077_0490083 3300049593 Bacteria 788
165 Ga0501080_0143103 3300049742 Bacteria 2211
166 Ga0501035_0270616 3300049822 Bacteria 1438
167 Ga0501044_0495497 3300049823 Bacteria 1123
168 Ga0501045_0175327 3300049824 Bacteria 1597
169 nmdc:mga05p37_1229_c1 3300050507 Bacteria 29692
170 nmdc:mga09592_4715_c1 3300050508 Bacteria 11035
171 nmdc:mga0qj67_7896_c1 3300050509 Bacteria 7862
172 nmdc:mga06r32_74_c1 3300050510 Bacteria 65502
173 nmdc:mga08y16_1640_c1 3300050511 Bacteria 22663
174 nmdc:mga0a205_22352_c2 3300050515 Bacteria 4892
175 Ga0495601_0055878 3300053077 Archaea 2500
176 Ga0495601_0285620 3300053077 Bacteria 1076
177 Ga0495619_0022515 3300053085 Bacteria 4033
178 Ga0501084_0194707 3300054114 Bacteria 1710
179 Ga0501082_0257572 3300060353 Bacteria 1518
180 Ga0501082_0314837 3300060353 Bacteria 1363
181 Ga0466962_0003436 3300061719 Bacteria 7541
182 Ga0466962_0008035 3300061719 Bacteria 5058
183 Ga0466962_0058773 3300061719 Bacteria 1835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100365545 Ga0070714_1003655452 154
2 3300005436 Ga0070713_100377804 Ga0070713_1003778042 154
3 3300006028 Ga0070717_10044587 Ga0070717_100445872 154
4 3300025928 Ga0207700_10603217 Ga0207700_106032171 154
5 3300025929 Ga0207664_10031269 Ga0207664_100312695 154
6 3300014325 Ga0163163_10768301 Ga0163163_107683012 157
7 3300046461 Ga0495641_0272776 Ga0495641_0272776_223_735 160
8 3300046511 Ga0495608_0243542 Ga0495608_0243542_224_736 160
9 3300047319 Ga0495674_0132781 Ga0495674_0132781_236_748 160
10 3300047322 Ga0495680_0232890 Ga0495680_0232890_349_861 160
11 iso_pu_bacteria 8056207758 8056214290 165
12 3300005435 Ga0070714_100059502 Ga0070714_1000595023 166
13 3300025929 Ga0207664_10049603 Ga0207664_100496032 166
14 3300048912 Ga0496109_1322004 Ga0496109_1322004_57_563 166
15 3300049568 Ga0501031_0068109 Ga0501031_0068109_570_1079 166
16 3300049571 Ga0501034_0268333 Ga0501034_0268333_1049_1558 166
17 3300049572 Ga0501036_0021534 Ga0501036_0021534_3842_4351 166
18 3300049573 Ga0501037_0015820 Ga0501037_0015820_4131_4640 166
19 3300049579 Ga0501043_0448172 Ga0501043_0448172_79_588 166
20 3300049581 Ga0501047_0153821 Ga0501047_0153821_188_697 166
21 3300049583 Ga0501067_0218213 Ga0501067_0218213_440_949 166
22 3300049586 Ga0501070_0210871 Ga0501070_0210871_53_562 166
23 3300049589 Ga0501073_0078647 Ga0501073_0078647_784_1293 166
24 3300049742 Ga0501080_0143103 Ga0501080_0143103_859_1368 166
25 3300049822 Ga0501035_0270616 Ga0501035_0270616_735_1244 166
26 3300049823 Ga0501044_0495497 Ga0501044_0495497_439_948 166
27 3300060353 Ga0501082_0257572 Ga0501082_0257572_166_675 166
28 iso_pu_bacteria 2675903060 2676495527 166
29 iso_pu_bacteria 2895427314 2895435305 166
30 3300005434 Ga0070709_11041386 Ga0070709_110413861 167
31 3300005435 Ga0070714_100045234 Ga0070714_1000452344 167
32 3300005435 Ga0070714_100525232 Ga0070714_1005252323 167
33 3300005436 Ga0070713_100062340 Ga0070713_1000623403 167
34 3300005436 Ga0070713_100114085 Ga0070713_1001140852 167
35 3300005437 Ga0070710_10020148 Ga0070710_100201482 167
36 3300005437 Ga0070710_10566778 Ga0070710_105667781 167
37 3300005937 Ga0081455_10000245 Ga0081455_1000024559 167
38 3300005937 Ga0081455_10152382 Ga0081455_101523822 167
39 3300005937 Ga0081455_10209111 Ga0081455_102091112 167
40 3300005937 Ga0081455_10316450 Ga0081455_103164502 167
41 3300005937 Ga0081455_10476297 Ga0081455_104762971 167
42 3300005983 Ga0081540_1002232 Ga0081540_10022325 167
43 3300005985 Ga0081539_10163518 Ga0081539_101635182 167
44 3300006028 Ga0070717_10020610 Ga0070717_100206101 167
45 3300006028 Ga0070717_10067935 Ga0070717_100679353 167
46 3300006028 Ga0070717_11290690 Ga0070717_112906901 167
47 3300006175 Ga0070712_100561968 Ga0070712_1005619682 167
48 3300006846 Ga0075430_100018312 Ga0075430_1000183129 167
49 3300006847 Ga0075431_100021173 Ga0075431_1000211738 167
50 3300006852 Ga0075433_10111505 Ga0075433_101115052 167
51 3300006880 Ga0075429_100024282 Ga0075429_1000242825 167
52 3300009093 Ga0105240_12291105 Ga0105240_122911051 167
53 3300009094 Ga0111539_10071358 Ga0111539_100713583 167
54 3300009147 Ga0114129_10005718 Ga0114129_1000571820 167
55 3300021384 Ga0213876_10005629 Ga0213876_100056291 167
56 3300021388 Ga0213875_10102339 Ga0213875_101023392 167
57 3300025898 Ga0207692_10046716 Ga0207692_100467162 167
58 3300025915 Ga0207693_10001903 Ga0207693_100019035 167
59 3300025928 Ga0207700_10021692 Ga0207700_100216921 167
60 3300025928 Ga0207700_10600174 Ga0207700_106001742 167
61 3300025929 Ga0207664_10140881 Ga0207664_101408812 167
62 3300025929 Ga0207664_10906037 Ga0207664_109060371 167
63 3300027907 Ga0207428_10007647 Ga0207428_1000764712 167
64 3300035117 Ga0373953_0044182 Ga0373953_0044182_985_1497 167
65 3300035119 Ga0373956_0129218 Ga0373956_0129218_130_642 167
66 3300035724 Ga0373933_0147316 Ga0373933_0147316_546_1058 167
67 3300036401 Ga0373937_0351808 Ga0373937_0351808_276_788 167
68 3300036401 Ga0373937_0414770 Ga0373937_0414770_381_893 167
69 3300036647 Ga0316582_0164930 Ga0316582_0164930_355_876 167
70 3300037068 Ga0373925_0931939 Ga0373925_0931939_33_545 167
71 3300037418 Ga0395900_0867713 Ga0395900_0867713_72_584 167
72 3300037466 Ga0395898_1292313 Ga0395898_1292313_112_624 167
73 3300037853 Ga0436364_0182925 Ga0436364_0182925_556_1068 167
74 3300037853 Ga0436364_1098086 Ga0436364_1098086_1535_2047 167
75 3300037853 Ga0436364_1156881 Ga0436364_1156881_29_547 167
76 3300037853 Ga0436364_1536816 Ga0436364_1536816_315_827 167
77 3300038443 Ga0395901_0273055 Ga0395901_0273055_840_1352 167
78 3300038443 Ga0395901_0751489 Ga0395901_0751489_139_654 167
79 3300039437 Ga0436365_0094735 Ga0436365_0094735_11737_12249 167
80 3300039437 Ga0436365_1509531 Ga0436365_1509531_390_905 167
81 3300039450 Ga0436363_1378490 Ga0436363_1378490_144_656 167
82 3300039453 Ga0436362_0556454 Ga0436362_0556454_806_1321 167
83 3300044684 Ga0466966_0448593 Ga0466966_0448593_55_567 167
84 3300044693 Ga0466961_0059700 Ga0466961_0059700_1585_2097 167
85 3300044694 Ga0466963_0005833 Ga0466963_0005833_6002_6520 167
86 3300044694 Ga0466963_0031605 Ga0466963_0031605_1410_1922 167
87 3300044694 Ga0466963_0051496 Ga0466963_0051496_899_1411 167
88 3300044694 Ga0466963_0170913 Ga0466963_0170913_959_1471 167
89 3300044706 Ga0466964_0104071 Ga0466964_0104071_405_917 167
90 3300044719 Ga0466971_0000320 Ga0466971_0000320_9969_10481 167
91 3300044719 Ga0466971_0063780 Ga0466971_0063780_764_1276 167
92 3300044735 Ga0466968_0050742 Ga0466968_0050742_92_604 167
93 3300045049 Ga0466959_0006226 Ga0466959_0006226_7420_7932 167
94 3300045049 Ga0466959_0030772 Ga0466959_0030772_1992_2504 167
95 3300045049 Ga0466959_0080329 Ga0466959_0080329_497_1009 167
96 3300045836 Ga0466958_0032410 Ga0466958_0032410_1873_2385 167
97 3300045836 Ga0466958_0154573 Ga0466958_0154573_24_536 167
98 3300045836 Ga0466958_0462318 Ga0466958_0462318_239_751 167
99 3300045976 Ga0466967_0058924 Ga0466967_0058924_317_829 167
100 3300045976 Ga0466967_0077958 Ga0466967_0077958_1168_1680 167
101 3300045976 Ga0466967_0088883 Ga0466967_0088883_26_538 167
102 3300045976 Ga0466967_0476810 Ga0466967_0476810_467_979 167
103 3300046454 Ga0495592_0059721 Ga0495592_0059721_94_606 167
104 3300046454 Ga0495592_0332349 Ga0495592_0332349_327_839 167
105 3300046463 Ga0495653_0232083 Ga0495653_0232083_610_1122 167
106 3300046511 Ga0495608_0001330 Ga0495608_0001330_14165_14677 167
107 3300046514 Ga0495618_0095988 Ga0495618_0095988_474_986 167
108 3300046516 Ga0495628_0052849 Ga0495628_0052849_2246_2758 167
109 3300046529 Ga0495652_0062403 Ga0495652_0062403_528_1040 167
110 3300046529 Ga0495652_0143216 Ga0495652_0143216_565_1077 167
111 3300046536 Ga0495587_0142520 Ga0495587_0142520_38_550 167
112 3300046559 Ga0495667_0010746 Ga0495667_0010746_416_928 167
113 3300046642 Ga0495634_0208383 Ga0495634_0208383_57_569 167
114 3300046675 Ga0495657_0571394 Ga0495657_0571394_94_606 167
115 3300046678 Ga0495599_0105572 Ga0495599_0105572_331_843 167
116 3300046680 Ga0495646_0040900 Ga0495646_0040900_355_867 167
117 3300046689 Ga0495613_0390875 Ga0495613_0390875_83_595 167
118 3300047315 Ga0495581_0247491 Ga0495581_0247491_52_564 167
119 3300047319 Ga0495674_0085877 Ga0495674_0085877_1950_2462 167
120 3300047319 Ga0495674_0173716 Ga0495674_0173716_590_1102 167
121 3300047322 Ga0495680_0661132 Ga0495680_0661132_76_588 167
122 3300047673 Ga0495593_0206773 Ga0495593_0206773_327_839 167
123 3300048088 Ga0495602_0072564 Ga0495602_0072564_1294_1806 167
124 3300048088 Ga0495602_0560844 Ga0495602_0560844_207_719 167
125 3300048912 Ga0496109_0144409 Ga0496109_0144409_1251_1763 167
126 3300049574 Ga0501038_0346271 Ga0501038_0346271_406_918 167
127 3300049576 Ga0501040_0087724 Ga0501040_0087724_558_1070 167
128 3300049578 Ga0501042_0488820 Ga0501042_0488820_143_655 167
129 3300049579 Ga0501043_0539025 Ga0501043_0539025_168_680 167
130 3300049581 Ga0501047_0060362 Ga0501047_0060362_2572_3108 167
131 3300049591 Ga0501075_0351159 Ga0501075_0351159_261_773 167
132 3300049593 Ga0501077_0342057 Ga0501077_0342057_309_821 167
133 3300049593 Ga0501077_0490083 Ga0501077_0490083_183_731 167
134 3300049824 Ga0501045_0175327 Ga0501045_0175327_862_1374 167
135 3300050507 nmdc:mga05p37_1229_c1 nmdc:mga05p37_1229_c1_21126_21638 167
136 3300050508 nmdc:mga09592_4715_c1 nmdc:mga09592_4715_c1_2670_3182 167
137 3300050509 nmdc:mga0qj67_7896_c1 nmdc:mga0qj67_7896_c1_4645_5157 167
138 3300050510 nmdc:mga06r32_74_c1 nmdc:mga06r32_74_c1_59775_60287 167
139 3300050511 nmdc:mga08y16_1640_c1 nmdc:mga08y16_1640_c1_5188_5700 167
140 3300050515 nmdc:mga0a205_22352_c2 nmdc:mga0a205_22352_c2_2053_2565 167
141 3300053077 Ga0495601_0285620 Ga0495601_0285620_458_970 167
142 3300053085 Ga0495619_0022515 Ga0495619_0022515_1978_2490 167
143 3300054114 Ga0501084_0194707 Ga0501084_0194707_893_1405 167
144 3300060353 Ga0501082_0314837 Ga0501082_0314837_271_783 167
145 3300061719 Ga0466962_0003436 Ga0466962_0003436_5073_5585 167
146 3300005437 Ga0070710_10389504 Ga0070710_103895041 168
147 3300005439 Ga0070711_100230522 Ga0070711_1002305222 168
148 3300005578 Ga0068854_100844496 Ga0068854_1008444961 168
149 3300005718 Ga0068866_10583396 Ga0068866_105833961 168
150 3300006173 Ga0070716_100128529 Ga0070716_1001285292 168
151 3300006175 Ga0070712_100047804 Ga0070712_1000478041 168
152 3300006847 Ga0075431_101398575 Ga0075431_1013985751 168
153 3300009094 Ga0111539_10396859 Ga0111539_103968592 168
154 3300025906 Ga0207699_10186897 Ga0207699_101868972 168
155 3300025916 Ga0207663_10630601 Ga0207663_106306012 168
156 3300025927 Ga0207687_10441080 Ga0207687_104410802 168
157 3300025939 Ga0207665_10055986 Ga0207665_100559863 168
158 3300037853 Ga0436364_0797693 Ga0436364_0797693_3087_3638 168
159 3300044706 Ga0466964_0199490 Ga0466964_0199490_177_761 168
160 3300045049 Ga0466959_0286054 Ga0466959_0286054_128_682 168
161 3300045836 Ga0466958_0073076 Ga0466958_0073076_151_705 168
162 3300046462 Ga0495651_0003583 Ga0495651_0003583_1902_2471 168
163 3300047317 Ga0495604_0338427 Ga0495604_0338427_187_756 168
164 3300047444 Ga0495675_0092846 Ga0495675_0092846_544_1113 168
165 3300047471 Ga0495684_0060438 Ga0495684_0060438_1894_2463 168
166 3300048903 Ga0496100_0989540 Ga0496100_0989540_73_615 168
167 3300048913 Ga0496110_0306476 Ga0496110_0306476_535_1077 168
168 3300048917 Ga0496114_0229910 Ga0496114_0229910_1062_1604 168
169 3300053077 Ga0495601_0055878 Ga0495601_0055878_881_1450 168
170 3300061719 Ga0466962_0008035 Ga0466962_0008035_3390_3944 168
171 3300061719 Ga0466962_0058773 Ga0466962_0058773_849_1403 168
172 3300026067 Ga0207678_10114554 Ga0207678_101145542 169
173 3300031824 Ga0307413_10121257 Ga0307413_101212572 169
174 3300005344 Ga0070661_100309238 Ga0070661_1003092382 170
175 3300005356 Ga0070674_100522002 Ga0070674_1005220021 170
176 3300005441 Ga0070700_100416721 Ga0070700_1004167212 170
177 3300005457 Ga0070662_100031394 Ga0070662_1000313942 170
178 3300005539 Ga0068853_100402224 Ga0068853_1004022242 170
179 3300005719 Ga0068861_100769404 Ga0068861_1007694041 170
180 3300009094 Ga0111539_12032780 Ga0111539_120327801 170
181 3300009098 Ga0105245_10407486 Ga0105245_104074862 170
182 3300009553 Ga0105249_11068457 Ga0105249_110684572 170
183 3300025937 Ga0207669_10482690 Ga0207669_104826901 170
184 3300025961 Ga0207712_10552947 Ga0207712_105529472 170
185 3300026118 Ga0207675_100611182 Ga0207675_1006111822 170
186 3300032126 Ga0307415_100407257 Ga0307415_1004072571 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

43

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9363 11 103
5yi0-assembly1.cif.gz_B structure of lactococcus lactis zitr, c30ah42a mutant 0.9289 23 85
5k5q-assembly1.cif.gz_D structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.9156 27 88
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9139 12 101
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9128 12 102
ID Description Score Start End Superfamily
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9389 15 103 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9186 15 103 1.10.10.10
af_P71983_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9102 10 105 1.10.10.10
af_Q58088_26_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8948 24 88 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8943 39 81 3.30.230.130
ID Description Score Start End GO Terms
AF-A0A0E4CNP6-F1-model_v4 Transcriptional regulator 0.9751 11 105 GO:0003677
AF-A0A1C4ZUQ7-F1-model_v4 Transcriptional regulator, HxlR family 0.9729 10 103 GO:0003677
AF-A0A1I0LMX7-F1-model_v4 Transcriptional regulator, HxlR family 0.9725 1 170 GO:0003677
AF-A0A2N0X645-F1-model_v4 Transcriptional regulator 0.9698 11 103 GO:0003677
AF-A0A557YUT4-F1-model_v4 deleted 0.9691 1 170

Feature Viewer

pLDDT pTM Quality
89.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map